Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFA1, Human

BPIFA1 Protein, a lipid-binding protein, exhibits high specificity for the surfactant phospholipid DPPC. It plays a crucial role in the innate immune responses of the upper airways, reducing surface tension, inhibiting biofilm formation by pathogenic bacteria, and negatively regulating proteolytic cleavage of SCNN1G, contributing to airway surface liquid homeostasis. BPIFA1 may also attract macrophages and neutrophils. BPIFA1 Protein, Human is the recombinant human-derived BPIFA1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

BPIFA1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bpifa1-protein-human.html

Purity

96.00

Smiles

QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV

Molecular Formula

51297 (Gene_ID) Q9NP55-1 (Q20-V256) (Accession)

Molecular Weight

Approximately 24.8 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LRPPRC (NM_133259) Human Tagged Lenti ORF Clone
RC216747L1 10 µg

LRPPRC (NM_133259) Human Tagged Lenti ORF Clone

Ask
View Details
Lentiviral human FBXO39 shRNA (UAS) - Lentiviral human FBXO39 shRNA (UAS, GFP) plasmid
GTR15114658 1 Vial

Lentiviral human FBXO39 shRNA (UAS) - Lentiviral human FBXO39 shRNA (UAS, GFP) plasmid

Ask
View Details
PKHG1, CT (PLEKHG1, KIAA1209, Pleckstrin homology domain-containing family G member 1) (MaxLight 650)
MBS6334407-01 0.1 mL

PKHG1, CT (PLEKHG1, KIAA1209, Pleckstrin homology domain-containing family G member 1) (MaxLight 650)

Ask
View Details
PKHG1, CT (PLEKHG1, KIAA1209, Pleckstrin homology domain-containing family G member 1) (MaxLight 650)
MBS6334407-02 5x 0.1 mL

PKHG1, CT (PLEKHG1, KIAA1209, Pleckstrin homology domain-containing family G member 1) (MaxLight 650)

Ask
View Details
Human Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL) ELISA Kit
abx258558-01 96 Tests

Human Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL) ELISA Kit

Ask
View Details
Human Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL) ELISA Kit
abx258558-02 5x 96 Tests

Human Aryl Hydrocarbon Receptor Nuclear Translocator Like Protein (ARNTL) ELISA Kit

Ask
View Details