Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin, Human (CHO)

Noggin is an antagonist of bone morphogenetic proteins (BMPs) and a member of the TGF-β superfamily, existing as a homodimer. Noggin binds to BMP-2/-4/-7 and inhibits their binding to BMPR-I/II receptors, thereby synergistically inducing bone differentiation in HMSCs, maintaining pluripotency in hESCs, inhibiting angiogenesis in HUVECs, and promoting myelination in oligodendrocytes, exerting neural activity[1][2][3][4]. Noggin Protein, Human (CHO) is a recombinant human Noggin protein expressed in CHO cells with tag-free.

Product Specifications

Product Name Alternative

Noggin Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/noggin-protein-human-cho.html

Purity

96.80

Smiles

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

9241 (Gene_ID) Q13253 (Q28-C232) (Accession)

Molecular Weight

Approximately 27-36 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Rifas L. The role of noggin in human mesenchymal stem cell differentiation. J Cell Biochem. 2007 Mar 1;100 (4) :824-34.|[2]Chaturvedi G, et al. Noggin maintains pluripotency of human embryonic stem cells grown on Matrigel. Cell Prolif. 2009 Aug;42 (4) :425-33.|[3]Kang HW, et al. In vitro and In vivo imaging of antivasculogenesis induced by Noggin protein expression in human venous endothelial cells. FASEB J. 2009 Dec;23 (12) :4126-34.|[4]Izrael M, et al. Human oligodendrocytes derived from embryonic stem cells: Effect of noggin on phenotypic differentiation in vitro and on myelination in vivo. Mol Cell Neurosci. 2007 Mar;34 (3) :310-23.|[5]Groppe J, et al. Structural basis of BMP signalling inhibition by the cystine knot protein Noggin. Nature. 2002 Dec 12;420 (6916) :636-42.|[6]Brunet LJ, et al. Noggin, cartilage morphogenesis, and joint formation in the mammalian skeleton. Science. 1998 May 29;280 (5368) :1455-7.|[7]Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113 (24) :2818-25.Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113 (24) :2818-25.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal UGT1A4 Antibody
NBP2-94266-0.1mL 0.1 mL

Rabbit Polyclonal UGT1A4 Antibody

Ask
View Details
TIMP1 (Tissue Inhibitor of Metalloproteinases 1, TIMP-1, TIMP, Metalloproteinase Inhibitor 1, Collagenase inhibitor, CLGI, Erythroid-potentiating Activity, EPA, Fibroblast Collagenase Inhibitor) (FITC) discontinued
143680-FITC 100 µL

TIMP1 (Tissue Inhibitor of Metalloproteinases 1, TIMP-1, TIMP, Metalloproteinase Inhibitor 1, Collagenase inhibitor, CLGI, Erythroid-potentiating Activity, EPA, Fibroblast Collagenase Inhibitor) (FITC) discontinued

Ask
View Details
Influenza A H1N1 (A/Texas/36/1991) Hemagglutinin/HA Insect Cell Lysate (WB positive control)
MBS8115875-01 0.3 mg

Influenza A H1N1 (A/Texas/36/1991) Hemagglutinin/HA Insect Cell Lysate (WB positive control)

Ask
View Details
Influenza A H1N1 (A/Texas/36/1991) Hemagglutinin/HA Insect Cell Lysate (WB positive control)
MBS8115875-02 5x 0.3 mg

Influenza A H1N1 (A/Texas/36/1991) Hemagglutinin/HA Insect Cell Lysate (WB positive control)

Ask
View Details
Anti-AKT Antibody
CPA1035-01 30 µL

Anti-AKT Antibody

Ask
View Details
Anti-AKT Antibody
CPA1035-02 50 μL

Anti-AKT Antibody

Ask
View Details