Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Delta-like 3/DLL3, Human (P.pastoris, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Delta-like protein 3/DLL3 Protein, Human (P.pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/delta-like-protein-3-dll3-protein-human-p-pastoris-his.html

Purity

90.00

Smiles

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Molecular Formula

10683 (Gene_ID) Q9NYJ7-1 (A27-L492) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-500 1x 500 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
BNC940633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-500 1x 500 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-500 1x 500 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details