Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNRF3, Human (HEK293, His)

ZNRF3, as an E3 ubiquitin protein ligase, plays a crucial role as a negative regulator in the Wnt signaling pathway. It does this by mediating the ubiquitination and subsequent degradation of components within the Wnt receptor complex, namely Frizzled and LRP6. ZNRF3 Protein, Human (HEK293, His) is the recombinant human-derived ZNRF3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ZNRF3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/znrf3-protein-human-hek293-his.html

Purity

96.0

Smiles

KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Molecular Formula

84133 (Gene_ID) Q9ULT6-1 (K56-M219) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Neutrophil Alkaline Phosphatase ELISA kit
GTR10418859 96 Well

Guinea Pig Neutrophil Alkaline Phosphatase ELISA kit

Sign In for Pricing
View Details
Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 0.5 mL, Sterile, Amber, with EPDM ring Cap, DNase/RNase free 1000 un. - ABDOS
P10224A 1000 Units/Pack

Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 0.5 mL, Sterile, Amber, with EPDM ring Cap, DNase/RNase free 1000 un. - ABDOS

Sign In for Pricing
View Details
Interleukin 17 Receptor C (IL17RC) Antibody
abx102765-01 100 µL

Interleukin 17 Receptor C (IL17RC) Antibody

Sign In for Pricing
View Details
Interleukin 17 Receptor C (IL17RC) Antibody
abx102765-02 200 µL

Interleukin 17 Receptor C (IL17RC) Antibody

Sign In for Pricing
View Details
Interleukin 17 Receptor C (IL17RC) Antibody
abx102765-03 1 mL

Interleukin 17 Receptor C (IL17RC) Antibody

Sign In for Pricing
View Details
Acadsb (NM_025826) Mouse Tagged ORF Clone
MG206889 10 µg

Acadsb (NM_025826) Mouse Tagged ORF Clone

Sign In for Pricing
View Details