Siglec-15, Human (HEK293, His)
The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, His) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
Siglec-15 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-his.html
Purity
98.0
Smiles
FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Molecular Formula
284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)
Molecular Weight
30-40 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![[2-[ (2-Amino-4-chlorophenyl) amino]phenyl] (4-methyl-1-piperazinyl) methanone](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
159254 10 mg
[2-[ (2-Amino-4-chlorophenyl) amino]phenyl] (4-methyl-1-piperazinyl) methanone
Sign In for Pricing
View Details K2571604 1.0 µg DNA
UBE2E3 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
bs-6006R-APC-Cy7 100 µL
FBXO31 Polyclonal Antibody, APC-Cy7 Conjugated
Sign In for Pricing
View Details 