Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PC4/SUB1, Human (His)

The PC4/SUB1 protein acts as a multifunctional coactivator that cooperates with TAF to promote functional interactions between upstream activators and the general transcription machinery. Its role extends to the potential stability of multiprotein transcription complexes. PC4/SUB1 Protein, Human (His) is the recombinant human-derived PC4/SUB1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PC4/SUB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pc4-sub1-protein-human-his.html

Purity

98.0

Smiles

MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

Molecular Formula

10923 (Gene_ID) P53999 (M1-L127) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ch TOG/CKAP5 Antibody Picoband® (monoclonal, 3C13) (Dylight488 Conjugate)
M05324-Dylight488 100 µg

Anti-ch TOG/CKAP5 Antibody Picoband® (monoclonal, 3C13) (Dylight488 Conjugate)

Sign In for Pricing
View Details
Olr779 Protein Lysate (Rat) with C-HA Tag
34673036 100 µg

Olr779 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Polyclonal Anti-GLUT4 Antibody
GWB-BBP597 0.1 mg

Polyclonal Anti-GLUT4 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal NOD1 Antibody
NBP2-57631 100 µL

Rabbit Polyclonal NOD1 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Snrnp200 shRNA (UAS) - Lentiviral mouse Snrnp200 shRNA (UAS, iRFP) plasmid
GTR15176968 1 Vial

Lentiviral mouse Snrnp200 shRNA (UAS) - Lentiviral mouse Snrnp200 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Sheep Olfactory receptor 6C3 (OR6C3) ELISA Kit
GTR10355041 96 Well

Sheep Olfactory receptor 6C3 (OR6C3) ELISA Kit

Sign In for Pricing
View Details