BCA-1/CXCL13, Human
CXCL13, known as BCA-1 (B cell-attracting chemokine 1) or BLC (B-lymphocyte chemoattractant), is an efficacious attractant selective for B lymphocytes through binding to the BLR1/CXCR5 receptor[1]. CXCL13 is a homeostatic chemokine, and is constitutively secreted by stromal cells in B-cell areas of secondary lymphoid tissues (follicles), such as spleen, lymph nodes, tonsils, and Peyer's patches[2]. BCA-1/CXCL13 Protein, Human is produced in E. coli, and consists of 87 amino acids (V23-P109) .
Product Specifications
Product Name Alternative
BCA-1/CXCL13 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-human.html
Purity
98.00
Smiles
VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Molecular Formula
10563 (Gene_ID) O43927 (V23-P109) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal ILT6/CD85e/LILRA3 Antibody [mFluor Violet 610 SE]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
Rabbit Polyclonal ILT6/CD85e/LILRA3 Antibody [mFluor Violet 610 SE]
NRGN CRISPRa sgRNA lentivector (set of three targets)(Human)