Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell antigen CD7 (CD7), partial

Product Specifications

Product Name Alternative

CD7; CD7 antigen (p41) ; CD7 antigen; CD7 molecule; CD7_HUMAN; GP40; LEU 9; LEU9; p41 protein; T cell antigen CD7; T cell leukemia antigen ; T cell surface antigen Leu 9; T-cell antigen CD7; T-cell leukemia antigen; T-cell surface antigen Leu-9; Tp 40; Tp40; TP41

Abbreviation

Recombinant Human CD7 protein, partial

Gene Name

CD7

UniProt

P09564

Expression Region

26-180aa

Organism

Homo sapiens (Human)

Target Sequence

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
BNC400177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-100 1x 100 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details