Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TSEN34, GST-tagged
TSEN34-3444H 25 µg

Recombinant Human TSEN34, GST-tagged

Sign In for Pricing
View Details
Anti-Collagen 15 alpha 1 Antibody
CPA3567-01 30 µL

Anti-Collagen 15 alpha 1 Antibody

Sign In for Pricing
View Details
Anti-Collagen 15 alpha 1 Antibody
CPA3567-02 50 μL

Anti-Collagen 15 alpha 1 Antibody

Sign In for Pricing
View Details
Anti-Collagen 15 alpha 1 Antibody
CPA3567-03 100 µL

Anti-Collagen 15 alpha 1 Antibody

Sign In for Pricing
View Details
Anti-Collagen 15 alpha 1 Antibody
CPA3567-04 200 µL

Anti-Collagen 15 alpha 1 Antibody

Sign In for Pricing
View Details
IACS-010759 (hydrochloride)
HY-112037A-01 5 mg

IACS-010759 (hydrochloride)

Sign In for Pricing
View Details