Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Carboxypeptidase A1/CPA1 Antibody (rCPA1/8689) [DyLight 680]
NBP3-21093FR 0.1 mL

Mouse Monoclonal Carboxypeptidase A1/CPA1 Antibody (rCPA1/8689) [DyLight 680]

Sign In for Pricing
View Details
PCNA Mouse Monoclonal Antibody [Clone ID: OTI6A10]
TA800975 100 µL

PCNA Mouse Monoclonal Antibody [Clone ID: OTI6A10]

Sign In for Pricing
View Details
Rabbit Polyclonal WWP2 Antibody [Janelia Fluor 549]
NBP1-49942JF549 0.1 mL

Rabbit Polyclonal WWP2 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Claudin 4 (CLDN4) Antibody
abx013032-01 10 µg

Claudin 4 (CLDN4) Antibody

Sign In for Pricing
View Details
Claudin 4 (CLDN4) Antibody
abx013032-02 100 µg

Claudin 4 (CLDN4) Antibody

Sign In for Pricing
View Details
Claudin 4 (CLDN4) Antibody
abx013032-03 200 µg

Claudin 4 (CLDN4) Antibody

Sign In for Pricing
View Details