Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cellulose Extraction Thimbles, Without Binder, 80 OD x 250 H, 2.5~3.0 mm thickness, 25pcs/pk
22031030 25 Pieces

Cellulose Extraction Thimbles, Without Binder, 80 OD x 250 H, 2.5~3.0 mm thickness, 25pcs/pk

Sign In for Pricing
View Details
Mouse Astrocyte Cell Complete Medium
MBS2577032-01 100 mL

Mouse Astrocyte Cell Complete Medium

Sign In for Pricing
View Details
Mouse Astrocyte Cell Complete Medium
MBS2577032-02 4x 125 mL

Mouse Astrocyte Cell Complete Medium

Sign In for Pricing
View Details
Pigeon EF-Hand Domain-Containing Family Member A2 (EFHA2) ELISA Kit
MBS9353312 Inquire

Pigeon EF-Hand Domain-Containing Family Member A2 (EFHA2) ELISA Kit

Sign In for Pricing
View Details
PROTAC BRD4-DCAF1 degrader-1
MF-0110352-01 10 mg

PROTAC BRD4-DCAF1 degrader-1

Sign In for Pricing
View Details
PROTAC BRD4-DCAF1 degrader-1
MF-0110352-02 50 mg

PROTAC BRD4-DCAF1 degrader-1

Sign In for Pricing
View Details