Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Laminin beta 1 Antibody [Alexa Fluor 700]
NB120-6571AF700 0.1 mL

Rabbit Polyclonal Laminin beta 1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Guinea Pig ALP-B ELISA Kit
EGA0794 96 Tests

Guinea Pig ALP-B ELISA Kit

Sign In for Pricing
View Details
Bestrophin Antibody
E51A05924 100 µL

Bestrophin Antibody

Sign In for Pricing
View Details
NAIP Antibody
GWB-25508F 0.05 mg

NAIP Antibody

Sign In for Pricing
View Details
PTOV1 (NM_017432) Human Tagged Lenti ORF Clone
RC208317L3 10 µg

PTOV1 (NM_017432) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mitogen-Activated Protein Kinase Kinase Kinase 7 (MAP3K7) Mouse ELISA Kit
F0508 96 Tests

Mitogen-Activated Protein Kinase Kinase Kinase 7 (MAP3K7) Mouse ELISA Kit

Sign In for Pricing
View Details