Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRP-1 CRISPR/Cas9 KO Plasmid (h)
sc-402086 20 µg

FRP-1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (H7E8) [FITC]
NB500-532F 0.1 mL

Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (H7E8) [FITC]

Sign In for Pricing
View Details
L3 Medium
B2023207 1 L

L3 Medium

Sign In for Pricing
View Details
pCMV-SPORT6-DEPTOR Plasmid
PVT13073 2 µg

pCMV-SPORT6-DEPTOR Plasmid

Sign In for Pricing
View Details
Rat Ppm1h Pre-designed siRNA Set B
SI210923B 1 Each

Rat Ppm1h Pre-designed siRNA Set B

Sign In for Pricing
View Details
Bovine Platelet Factor 4 (PF4) ELISA Kit
MBS4501779-01 48 Tests

Bovine Platelet Factor 4 (PF4) ELISA Kit

Sign In for Pricing
View Details