Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH5A1 Antibody
A52983-100UL 100 µL

ALDH5A1 Antibody

Sign In for Pricing
View Details
5β-CHOLESTAN-3α-OL p-TOLUENESULPHONATE
503371 Inquire

5β-CHOLESTAN-3α-OL p-TOLUENESULPHONATE

Sign In for Pricing
View Details
TFPI-2 IHC Antibody
IW-PA1248 9 mL

TFPI-2 IHC Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Histone H3 [p Thr6] Antibody (RM160) [Janelia Fluor 549]
NBP3-26020JF549 0.1 mL

Rabbit Monoclonal Histone H3 [p Thr6] Antibody (RM160) [Janelia Fluor 549]

Sign In for Pricing
View Details
Arhgap33 (NM_178252) Mouse Tagged ORF Clone Lentiviral Particle
MR211906L3V 200 µL

Arhgap33 (NM_178252) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RGAG4 CRISPRa sgRNA lentivector (set of three targets)(Human)
38893121 3x 1.0µg DNA

RGAG4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details