Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMA2 (Laminin, alpha 2, LAMM) (FITC)
248059-FITC 100 µL

LAMA2 (Laminin, alpha 2, LAMM) (FITC)

Sign In for Pricing
View Details
CALL5 (CALML5, CLSP, Calmodulin-like Protein 5, Calmodulin-like Skin Protein) (HRP)
MBS6372018-01 0.1 mL

CALL5 (CALML5, CLSP, Calmodulin-like Protein 5, Calmodulin-like Skin Protein) (HRP)

Sign In for Pricing
View Details
CALL5 (CALML5, CLSP, Calmodulin-like Protein 5, Calmodulin-like Skin Protein) (HRP)
MBS6372018-02 5x 0.1 mL

CALL5 (CALML5, CLSP, Calmodulin-like Protein 5, Calmodulin-like Skin Protein) (HRP)

Sign In for Pricing
View Details
Human SLC14A2 knockdown cell line
ABC-KD13874 1 Vial

Human SLC14A2 knockdown cell line

Sign In for Pricing
View Details
Prokaryotic Human RAB7A, Member RAS Oncogene Family
RPU61888-01 50 µg

Prokaryotic Human RAB7A, Member RAS Oncogene Family

Sign In for Pricing
View Details
Prokaryotic Human RAB7A, Member RAS Oncogene Family
RPU61888-02 100 µg

Prokaryotic Human RAB7A, Member RAS Oncogene Family

Sign In for Pricing
View Details