Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rad51 ORF Vector (Rat) (pORF)
38419016 1.0 µg DNA

Rad51 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PHPT1 (NM_014172) Human Untagged Clone
SC108149 10 µg

PHPT1 (NM_014172) Human Untagged Clone

Sign In for Pricing
View Details
FAM84B Over-expression Lysate Product
GWB-775A3F 0.1 mg

FAM84B Over-expression Lysate Product

Sign In for Pricing
View Details
PRRC2A Protein Vector (Rat) (pPM-C-HA)
37812026 500 ng

PRRC2A Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Glucocorticoid Receptor Alpha (NR3C1) Antibody
abx102862-01 100 µL

Glucocorticoid Receptor Alpha (NR3C1) Antibody

Sign In for Pricing
View Details
Glucocorticoid Receptor Alpha (NR3C1) Antibody
abx102862-02 200 µL

Glucocorticoid Receptor Alpha (NR3C1) Antibody

Sign In for Pricing
View Details