Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCRB, ID (TCRB, T-cell receptor beta chain V region CTL-L17) (AP)
MBS6354590-01 0.2 mL

TCRB, ID (TCRB, T-cell receptor beta chain V region CTL-L17) (AP)

Sign In for Pricing
View Details
TCRB, ID (TCRB, T-cell receptor beta chain V region CTL-L17) (AP)
MBS6354590-02 5x 0.2 mL

TCRB, ID (TCRB, T-cell receptor beta chain V region CTL-L17) (AP)

Sign In for Pricing
View Details
Olfr1204 (NM_146463) Mouse Tagged Lenti ORF Clone
MR212485L3 10 µg

Olfr1204 (NM_146463) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
C19orf70 3'UTR GFP Stable Cell Line
TU053178 1.0 mL

C19orf70 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Stainless Steel Scalpel Holder No. 4
LA830-2NO 1 unit

Stainless Steel Scalpel Holder No. 4

Sign In for Pricing
View Details
CD73/NT5E Antibody
bsm-70415M 100 µL

CD73/NT5E Antibody

Sign In for Pricing
View Details