Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chk1, phosphorylated (Ser317) (CHEK1, Cell Cycle Checkpoint Kinase)
C4200-15 100 µL

Chk1, phosphorylated (Ser317) (CHEK1, Cell Cycle Checkpoint Kinase)

Sign In for Pricing
View Details
Mouse Mir6926 qPCR Primer Pair
QM80638S 200 Tests

Mouse Mir6926 qPCR Primer Pair

Sign In for Pricing
View Details
MAN1A2 (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB, Mannosidase alpha Class 1A Member 2, Processing alpha-1,2-mannosidase IB, Alpha-1,2-mannosidase IB, MAN1B) (MaxLight 490)
129340-ML490 100 µL

MAN1A2 (Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB, Mannosidase alpha Class 1A Member 2, Processing alpha-1,2-mannosidase IB, Alpha-1,2-mannosidase IB, MAN1B) (MaxLight 490)

Sign In for Pricing
View Details
HELQ rabbit pAb
RA32617-01 50 µL

HELQ rabbit pAb

Sign In for Pricing
View Details
HELQ rabbit pAb
RA32617-02 100 µL

HELQ rabbit pAb

Sign In for Pricing
View Details
Human PILR-alpha Alexa Fluor 700 MAb (Clone 2175D)
FAB64841N-100UG 100 µg

Human PILR-alpha Alexa Fluor 700 MAb (Clone 2175D)

Sign In for Pricing
View Details