Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHFR Recombinant Antibody, Cy3 Conjugated
bsm-61547R-Cy3-01 20 µL

DHFR Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
DHFR Recombinant Antibody, Cy3 Conjugated
bsm-61547R-Cy3-02 100 µL

DHFR Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
DNAL1 CRISPR Activation Plasmid (h)
sc-413479-ACT 20 µg

DNAL1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Sheep Chaperonin Containing TCP1, Subunit 2 ELISA Kit
MBS098310-01 48 Well

Sheep Chaperonin Containing TCP1, Subunit 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Chaperonin Containing TCP1, Subunit 2 ELISA Kit
MBS098310-02 96 Well

Sheep Chaperonin Containing TCP1, Subunit 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Chaperonin Containing TCP1, Subunit 2 ELISA Kit
MBS098310-03 5x 96 Well

Sheep Chaperonin Containing TCP1, Subunit 2 ELISA Kit

Sign In for Pricing
View Details