Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Neisseria Gonorrhoeae argB Protein (aa 1-298) (strain NCCP11945)
VAng-Wyb2456-500gEcoli 500 µg (E. coli)

Recombinant Neisseria Gonorrhoeae argB Protein (aa 1-298) (strain NCCP11945)

Sign In for Pricing
View Details
CBLB Polyclonal Antibody
BT-AP07183-01 20 µL

CBLB Polyclonal Antibody

Sign In for Pricing
View Details
CBLB Polyclonal Antibody
BT-AP07183-02 50 µL

CBLB Polyclonal Antibody

Sign In for Pricing
View Details
CBLB Polyclonal Antibody
BT-AP07183-03 100 µL

CBLB Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 592 Protein, GST, E.coli-100ug
QP8453-ec-100ug 100ug

Recombinant Human Zinc finger protein 592 Protein, GST, E.coli-100ug

Sign In for Pricing
View Details
MFGE8 Human shRNA Lentiviral Particle (Locus ID 4240)
TL311492V 500 µL Each

MFGE8 Human shRNA Lentiviral Particle (Locus ID 4240)

Sign In for Pricing
View Details