Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KCNH5 Polyclonal Antibody
MF-0078552-01 50 µL

Anti-KCNH5 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-KCNH5 Polyclonal Antibody
MF-0078552-02 100 µL

Anti-KCNH5 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-KCNH5 Polyclonal Antibody
MF-0078552-03 200 µL

Anti-KCNH5 Polyclonal Antibody

Sign In for Pricing
View Details
SLC8A1 (Sodium/Calcium Exchanger 1, Na (+) /Ca (2+) -Exchange Protein 1, Solute Carrier Family 8 Member 1, CNC, NCX1) discontinued
225875-01 50 µL

SLC8A1 (Sodium/Calcium Exchanger 1, Na (+) /Ca (2+) -Exchange Protein 1, Solute Carrier Family 8 Member 1, CNC, NCX1) discontinued

Sign In for Pricing
View Details
SLC8A1 (Sodium/Calcium Exchanger 1, Na (+) /Ca (2+) -Exchange Protein 1, Solute Carrier Family 8 Member 1, CNC, NCX1) discontinued
225875-02 100 µL

SLC8A1 (Sodium/Calcium Exchanger 1, Na (+) /Ca (2+) -Exchange Protein 1, Solute Carrier Family 8 Member 1, CNC, NCX1) discontinued

Sign In for Pricing
View Details
TBX1 Peptide
AF0327-BP 1 mg

TBX1 Peptide

Sign In for Pricing
View Details