Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAL17 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2501505 3x 1.0 µg

TRNAL17 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Guinea pig anti-CD206 Polyclonal Antibody
E48PA024 100 µL

Guinea pig anti-CD206 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human ATP5PO Protein, N-His
HW696012-01 50 µg

Recombinant Human ATP5PO Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ATP5PO Protein, N-His
HW696012-02 100 µg

Recombinant Human ATP5PO Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ATP5PO Protein, N-His
HW696012-03 1 mg

Recombinant Human ATP5PO Protein, N-His

Sign In for Pricing
View Details
MEIS2 (NM_170677) Human Over-expression Lysate
LS004212-20ug 20 µg

MEIS2 (NM_170677) Human Over-expression Lysate

Sign In for Pricing
View Details