Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tfap2a Protein Vector (Rat) (pPM-C-HA)
46556026 500 ng

Tfap2a Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Anti-Acidic Calponin antibody
SL12443R-01 50 µL

Rabbit Anti-Acidic Calponin antibody

Sign In for Pricing
View Details
Rabbit Anti-Acidic Calponin antibody
SL12443R-02 100 µL

Rabbit Anti-Acidic Calponin antibody

Sign In for Pricing
View Details
Vom1r90 (NM_153729) Rat Tagged Lenti ORF Clone
RR210341L3 10 µg

Vom1r90 (NM_153729) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Synaptonemal complex protein 2-like, SYCP2L ELISA KIT
ELI-13673h 96 Tests

Human Synaptonemal complex protein 2-like, SYCP2L ELISA KIT

Sign In for Pricing
View Details
SKI-178 2mg
A22510-2 2 mg

SKI-178 2mg

Sign In for Pricing
View Details