Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD43/Sialophorin Antibody (84-3C1) [DyLight 405]
NBP3-11445V 0.1 mL

Mouse Monoclonal CD43/Sialophorin Antibody (84-3C1) [DyLight 405]

Sign In for Pricing
View Details
PBX3, NT (PBX3, Pre-B Cell leukemia transcription factor 3, Homeobox protein PBX3) (MaxLight 750)
MBS6331262-01 0.1 mL

PBX3, NT (PBX3, Pre-B Cell leukemia transcription factor 3, Homeobox protein PBX3) (MaxLight 750)

Sign In for Pricing
View Details
PBX3, NT (PBX3, Pre-B Cell leukemia transcription factor 3, Homeobox protein PBX3) (MaxLight 750)
MBS6331262-02 5x 0.1 mL

PBX3, NT (PBX3, Pre-B Cell leukemia transcription factor 3, Homeobox protein PBX3) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit Polyclonal RFX1 Antibody [mFluor Violet 450 SE]
NBP2-82031MFV450 0.1 mL

Rabbit Polyclonal RFX1 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Filensin (BFSP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H6]
TA804079AM 100 µL

Filensin (BFSP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H6]

Sign In for Pricing
View Details
IGLV1-40 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1063605 3x 1.0 µg

IGLV1-40 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details