Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEXA antibody
FNab03842 100 µg

HEXA antibody

Sign In for Pricing
View Details
IGFBP5 Protein, Human, Recombinant (His Tag)
PH51790I2-01 100 µg

IGFBP5 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
IGFBP5 Protein, Human, Recombinant (His Tag)
PH51790I2-02 1 mg

IGFBP5 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
PLK2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1669203 1.0 µg DNA

PLK2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
HSD17B4 (Enoyl-CoA hydratase 2)
144482 100 µg

HSD17B4 (Enoyl-CoA hydratase 2)

Sign In for Pricing
View Details
MRPL47 (NM_177988) Human Over-expression Lysate
LY406075 100 µg

MRPL47 (NM_177988) Human Over-expression Lysate

Sign In for Pricing
View Details