Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Phosphate Buffer 0.2M, pH 7.5
41920142-3 500 mL

Sodium Phosphate Buffer 0.2M, pH 7.5

Sign In for Pricing
View Details
Rubella, E1 (German Measles) (PE)
MBS6244454-01 0.1 mL

Rubella, E1 (German Measles) (PE)

Sign In for Pricing
View Details
Rubella, E1 (German Measles) (PE)
MBS6244454-02 5x 0.1 mL

Rubella, E1 (German Measles) (PE)

Sign In for Pricing
View Details
Polyphyllin VI 5mg
A14587-5 5 mg

Polyphyllin VI 5mg

Sign In for Pricing
View Details
Rabbit Polyclonal EphA6 Antibody [Alexa Fluor 532]
NBP2-98326AF532 0.1 mL

Rabbit Polyclonal EphA6 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
FBXW4, CT (F-box/WD Repeat-containing Protein 4, F-box and WD-40 Domain-containing Protein 4, Dactylin, FBW4, SHFM3) (Biotin) discontinued
F0024-74-Biotin 200 µL

FBXW4, CT (F-box/WD Repeat-containing Protein 4, F-box and WD-40 Domain-containing Protein 4, Dactylin, FBW4, SHFM3) (Biotin) discontinued

Sign In for Pricing
View Details