Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPC7-AS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV754650 1.0 µg DNA

TRPC7-AS2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Ghrelin 28 Rabbit pAb
E47R1375 100 µL

Ghrelin 28 Rabbit pAb

Sign In for Pricing
View Details
NEUROG2 Antibody
A70753-50UG 50 µg

NEUROG2 Antibody

Sign In for Pricing
View Details
HDAC6 (Histone Deacetylase 6, HD6, KIAA0901, JM21) (FITC)
127768-FITC 100 µL

HDAC6 (Histone Deacetylase 6, HD6, KIAA0901, JM21) (FITC)

Sign In for Pricing
View Details
Usp21 sgRNA CRISPR Lentivector set (Mouse)
K3479201 3x 1.0 µg

Usp21 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Lentiviral human CSNK1A1 sgRNA gene knockout kit - Lentiviral human CSNK1A1 sgRNA gene knockout kit (100)
GTR15374491 1 Vial

Lentiviral human CSNK1A1 sgRNA gene knockout kit - Lentiviral human CSNK1A1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details