Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dictyostelium discoideum Probable serine/threonine-protein kinase abkD (abkD), partial
MBS7082836 Inquire

Recombinant Dictyostelium discoideum Probable serine/threonine-protein kinase abkD (abkD), partial

Sign In for Pricing
View Details
SLC38A5 Recombinant Protein Antigen
NBP1-92402PEP 0.1 mL

SLC38A5 Recombinant Protein Antigen

Sign In for Pricing
View Details
Rat Arhgef19 Pre-designed siRNA Set A
SI200883A 1 Each

Rat Arhgef19 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 23, Active Protein
RPU60266-01 50 µg

Mouse Fibroblast Growth Factor 23, Active Protein

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 23, Active Protein
RPU60266-02 100 µg

Mouse Fibroblast Growth Factor 23, Active Protein

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 23, Active Protein
RPU60266-03 1 mg

Mouse Fibroblast Growth Factor 23, Active Protein

Sign In for Pricing
View Details