Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12) nadB Polyclonal Antibody
MBS7152128 Inquire

Rabbit anti-Escherichia coli (strain K12) nadB Polyclonal Antibody

Sign In for Pricing
View Details
Snx20 (NM_001024999) Rat Tagged ORF Clone Lentiviral Particle
RR204824L4V 200 µL

Snx20 (NM_001024999) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SLC25A11 (NM_001165418) Human Tagged ORF Clone
RC228199 10 µg

SLC25A11 (NM_001165418) Human Tagged ORF Clone

Sign In for Pricing
View Details
C17orf80 Blocking Peptide (N-Term)
MBS9230089-01 0.5 mg

C17orf80 Blocking Peptide (N-Term)

Sign In for Pricing
View Details
C17orf80 Blocking Peptide (N-Term)
MBS9230089-02 5x 0.5 mg

C17orf80 Blocking Peptide (N-Term)

Sign In for Pricing
View Details
S100A8/A9 Mouse Monoclonal Antibody [Clone ID: LBI5C9]
AMM21555VCF 100 µg

S100A8/A9 Mouse Monoclonal Antibody [Clone ID: LBI5C9]

Sign In for Pricing
View Details