Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bglap Rat Pre-designed siRNA Set A
HY-RS24640 1 Set

Bglap Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Spectra/Por ® 3 Dry Standard RC Dialysis Tubing
LC9003-001 1 Roll

Spectra/Por ® 3 Dry Standard RC Dialysis Tubing

Sign In for Pricing
View Details
CRT0066854 hydrochloride
M32867-01 1 g

CRT0066854 hydrochloride

Sign In for Pricing
View Details
CRT0066854 hydrochloride
M32867-02 500 mg

CRT0066854 hydrochloride

Sign In for Pricing
View Details
CRT0066854 hydrochloride
M32867-03 5 mg

CRT0066854 hydrochloride

Sign In for Pricing
View Details
CRT0066854 hydrochloride
M32867-04 10 mg

CRT0066854 hydrochloride

Sign In for Pricing
View Details