Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABRR3 Protein Vector (Mouse) (pPB-N-His)
PV180991 500 ng

GABRR3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Monoclonal ILT3/CD85k/LILRB4 Antibody (293623) [mFluor Violet 450 SE]
FAB24251MFV450 0.1 mL

Mouse Monoclonal ILT3/CD85k/LILRB4 Antibody (293623) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Rabbit Polyclonal DNAJC17 Antibody
NBP1-84614-25ul 25 µL

Rabbit Polyclonal DNAJC17 Antibody

Sign In for Pricing
View Details
Gls2 Rat shRNA Lentiviral Particle (Locus ID 192268)
TL712959V 500 µL Each

Gls2 Rat shRNA Lentiviral Particle (Locus ID 192268)

Sign In for Pricing
View Details
KDM1B Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61638R-BF405-01 20 µL

KDM1B Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
KDM1B Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61638R-BF405-02 100 µL

KDM1B Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details