Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat MPC1 siRNA
abx924435-01 15 nmol

Rat MPC1 siRNA

Sign In for Pricing
View Details
Rat MPC1 siRNA
abx924435-02 30 nmol

Rat MPC1 siRNA

Sign In for Pricing
View Details
BCL7B 3'UTR GFP Stable Cell Line
TU051706 1.0 mL

BCL7B 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Erythropoietin alpha Human Protein
PR27065-5 5 µg

Erythropoietin alpha Human Protein

Sign In for Pricing
View Details
Saikosaponin C 1mg
A14571-1 1 mg

Saikosaponin C 1mg

Sign In for Pricing
View Details
Mouse Monoclonal DNA Antibody (SPM603) [PE]
NBP3-11432PE 0.1 mL

Mouse Monoclonal DNA Antibody (SPM603) [PE]

Sign In for Pricing
View Details