Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRPX (NM_006307) Human Tagged Lenti ORF Clone
RC204681L1 10 µg

SRPX (NM_006307) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Serine/Threonine-Protein Kinase Nek7 (NEK7) Peptide
abx616434 100 µg

Serine/Threonine-Protein Kinase Nek7 (NEK7) Peptide

Sign In for Pricing
View Details
FRA5C Recombinant Protein (Human)
RP059394 100 µg

FRA5C Recombinant Protein (Human)

Sign In for Pricing
View Details
STAT3, Phosphorylated (Y705) (Signal Transducer and Activator of Transcription 3, STAT3, Acute-phase Response Factor, APRF, HIES) (Biotin)
MBS6439192-01 0.1 mL

STAT3, Phosphorylated (Y705) (Signal Transducer and Activator of Transcription 3, STAT3, Acute-phase Response Factor, APRF, HIES) (Biotin)

Sign In for Pricing
View Details
STAT3, Phosphorylated (Y705) (Signal Transducer and Activator of Transcription 3, STAT3, Acute-phase Response Factor, APRF, HIES) (Biotin)
MBS6439192-02 5x 0.1 mL

STAT3, Phosphorylated (Y705) (Signal Transducer and Activator of Transcription 3, STAT3, Acute-phase Response Factor, APRF, HIES) (Biotin)

Sign In for Pricing
View Details
ITGB3BP Protein Vector (Human) (pPB-C-His)
PV021865 500 ng

ITGB3BP Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details