Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

JMJD6, NT (JmjC Domain-containing Protein 6, Jumonji Domain-containing Protein 6, Protein PTDSR, Jmjd6, Ptdsr, Bifunctional Arginine Demethylase And Lysyl-Hydroxylase JMJD6, Histone Arginine Demethylase JMJD6, Peptide-lysine 5-dioxygenase JMJD6, Lysyl-hydroxylase JMJD6, Phosphatidylserine Receptor) (MaxLight 550) discontinued
J7876-51-ML550 100 µL

JMJD6, NT (JmjC Domain-containing Protein 6, Jumonji Domain-containing Protein 6, Protein PTDSR, Jmjd6, Ptdsr, Bifunctional Arginine Demethylase And Lysyl-Hydroxylase JMJD6, Histone Arginine Demethylase JMJD6, Peptide-lysine 5-dioxygenase JMJD6, Lysyl-hydroxylase JMJD6, Phosphatidylserine Receptor) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Human Adiponectin Recombinant Rabbit Monoclonal Antibody [PSH05-32] - BSA and Azide free (Detector)
HA722261 100 µL

Human Adiponectin Recombinant Rabbit Monoclonal Antibody [PSH05-32] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Exd2 (NM_133798) Mouse Tagged ORF Clone Lentiviral Particle
MR207967L4V 200 µL

Exd2 (NM_133798) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human C17orf100 knockdown cell line
ABC-KD1792 1 Vial

Human C17orf100 knockdown cell line

Sign In for Pricing
View Details
Phospho-Histone H3 (S10) Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-52261R-BF350 100 µL

Phospho-Histone H3 (S10) Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O81 (strain ED1a) CMOA Polyclonal Antibody
MBS7174074 Inquire

Rabbit anti-Escherichia coli O81 (strain ED1a) CMOA Polyclonal Antibody

Sign In for Pricing
View Details