Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zfand3 activation kit by CRISPRa
GA204306 1 Kit

Mouse Zfand3 activation kit by CRISPRa

Sign In for Pricing
View Details
CD62L antibody (FITC)
61R-1103 100 ug

CD62L antibody (FITC)

Sign In for Pricing
View Details
Human FGF19 Protein, His Tag
32-18269-50 50 µg

Human FGF19 Protein, His Tag

Sign In for Pricing
View Details
RAB3IP (NM_022456) Human Untagged Clone
SC112519 10 µg

RAB3IP (NM_022456) Human Untagged Clone

Sign In for Pricing
View Details
TTNPB 25mg
A13007-25 25 mg

TTNPB 25mg

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Interleukin 2 Receptor Beta (IL2Rb)
MBS2128966-01 0.1 mL

FITC Linked Monoclonal Antibody to Interleukin 2 Receptor Beta (IL2Rb)

Sign In for Pricing
View Details