Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nor Dihydrocodeine 6-O-β-D-Glucuronide
460859 1 mg

Nor Dihydrocodeine 6-O-β-D-Glucuronide

Sign In for Pricing
View Details
Lentiviral human H2AB2 shRNA (UAS) - Lentiviral human H2AB2 shRNA (UAS) (25)
GTR15318620 1 Vial

Lentiviral human H2AB2 shRNA (UAS) - Lentiviral human H2AB2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Arl10 (NM_207165) Rat Untagged Clone
RN206416 10 µg

Arl10 (NM_207165) Rat Untagged Clone

Sign In for Pricing
View Details
Thiamine hydrochloride, Ph. Eur. grade
GP0613-500g 500 g

Thiamine hydrochloride, Ph. Eur. grade

Sign In for Pricing
View Details
HK1 Antibody / Hexokinase 1
V5728-20UG 20 µg

HK1 Antibody / Hexokinase 1

Sign In for Pricing
View Details
GSK3B Polyclonal Antibody
ANT-12432-100ug 100 µg

GSK3B Polyclonal Antibody

Sign In for Pricing
View Details