CD83, Cynomolgus (HEK293, His)
The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html
Purity
97.0
Smiles
TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA
Molecular Formula
701825 (Gene_ID) F6WX37 (T20-A143) (Accession)
Molecular Weight
Approximately 19&21&27 kDa.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
DR4 (Death Receptor 4, Apo2, CD261, CD261 Antigen, Cytotoxic Ligand TRAIL Receptor, Cytotoxic TRAIL Receptor, MGC9365, T10A, TNF Related Apoptosis Inducing Ligand Receptor 1, TRAIL Receptor 1, TRAIL R1, TRAILR1, TRAIL-R1, TRAILR-1, Tumor Necrosis Factor Receptor Superfamily Member 10a, TNFRSF10A) (FITC) discontinued
Mouse beta-Cross Linked C-Telopeptide Of Type I Collagen ELISA Kit
Mouse beta-Cross Linked C-Telopeptide Of Type I Collagen ELISA Kit
Mouse beta-Cross Linked C-Telopeptide Of Type I Collagen ELISA Kit
Mouse beta-Cross Linked C-Telopeptide Of Type I Collagen ELISA Kit
