Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBL4A Antibody
A60142-100UL 100 µL

UBL4A Antibody

Sign In for Pricing
View Details
Mouse Monoclonal SDHA Antibody (SDHA/7495) [Alexa Fluor 750]
NBP3-27014AF750 0.1 mL

Mouse Monoclonal SDHA Antibody (SDHA/7495) [Alexa Fluor 750]

Sign In for Pricing
View Details
GGN Rabbit pAb
E47R13347 100 µL

GGN Rabbit pAb

Sign In for Pricing
View Details
Mouse Tafa5 (NM_134096) AAV Particle
MR200644A1V 250 µL

Mouse Tafa5 (NM_134096) AAV Particle

Sign In for Pricing
View Details
pExpress-1-Tmem147 Plasmid
PVT41004 2 µg

pExpress-1-Tmem147 Plasmid

Sign In for Pricing
View Details
DKK1 Human shRNA Lentiviral Particle (Locus ID 22943)
TL313465V 500 µL Each

DKK1 Human shRNA Lentiviral Particle (Locus ID 22943)

Sign In for Pricing
View Details