Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abhd17b (NM_001014028) Rat Tagged ORF Clone Lentiviral Particle
RR204791L4V 200 µL

Abhd17b (NM_001014028) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TMEM62 Double Nickase Plasmid (h)
sc-413324-NIC 20 µg

TMEM62 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Cleaved PARP
MBS8533809-01 0.1 mL

Cleaved PARP

Sign In for Pricing
View Details
Cleaved PARP
MBS8533809-02 0.1 mL (AF405L)

Cleaved PARP

Sign In for Pricing
View Details
Cleaved PARP
MBS8533809-03 0.1 mL (AF405S)

Cleaved PARP

Sign In for Pricing
View Details
Cleaved PARP
MBS8533809-04 0.1 mL (AF610)

Cleaved PARP

Sign In for Pricing
View Details