Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEG2 antibody
70R-33824 100 ug

LEG2 antibody

Sign In for Pricing
View Details
GALNT9 (NM_021808) Human Over-expression Lysate
LS050614-20ug 20 µg

GALNT9 (NM_021808) Human Over-expression Lysate

Sign In for Pricing
View Details
TXNRD2 Peptide
AF5399-BP 1 mg

TXNRD2 Peptide

Sign In for Pricing
View Details
CD31 (PECAM-1, Platelet gpIIa Molecule) (MaxLight 405) discontinued
C2383-24-ML405 100 µL

CD31 (PECAM-1, Platelet gpIIa Molecule) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rat Cardiotrophin Like Cytokine Factor 1 (CLCF1) ELISA Kit
MBS2023615-01 24 Strip Well

Rat Cardiotrophin Like Cytokine Factor 1 (CLCF1) ELISA Kit

Sign In for Pricing
View Details
Rat Cardiotrophin Like Cytokine Factor 1 (CLCF1) ELISA Kit
MBS2023615-02 48 Well

Rat Cardiotrophin Like Cytokine Factor 1 (CLCF1) ELISA Kit

Sign In for Pricing
View Details