Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Cynomolgus (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Molecular Formula

701825 (Gene_ID) F6WX37 (T20-A143) (Accession)

Molecular Weight

Approximately 19&21&27 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5 3'UTR Luciferase Stable Cell Line
TU002331 1.0 mL

C5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PRMT6 antibody
FNab06792 100 µg

PRMT6 antibody

Sign In for Pricing
View Details
Human SLC26A7 (Solute Carrier Family 26, Member 7) ELISA Kit
EH25116 96 Tests

Human SLC26A7 (Solute Carrier Family 26, Member 7) ELISA Kit

Sign In for Pricing
View Details
Growth Differentiation Factor 15 (GDF15) Human ELISA Kit
D6535 96 Tests

Growth Differentiation Factor 15 (GDF15) Human ELISA Kit

Sign In for Pricing
View Details
Magic™ Membrane Protein Human CACNA2D3 (Calcium voltage-gated channel auxiliary subunit alpha2delta 3) Full Length
MPC0432K Each

Magic™ Membrane Protein Human CACNA2D3 (Calcium voltage-gated channel auxiliary subunit alpha2delta 3) Full Length

Sign In for Pricing
View Details
1-Methyl-1H-benzimidazole-2-methanol
409978-01 250 mg

1-Methyl-1H-benzimidazole-2-methanol

Sign In for Pricing
View Details