Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX5/Peroxiredoxin-5, Mouse (His)

The PRDX5/Peroxiredoxin-5 protein is a thiol-specific peroxidase that reduces hydrogen peroxide and organic hydroperoxides to water and alcohols. It plays a vital role in cellular protection from oxidative stress and detoxifying peroxides to maintain redox balance. PRDX5/Peroxiredoxin-5 Protein, Mouse (His) is the recombinant mouse-derived PRDX5/Peroxiredoxin-5 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PRDX5/Peroxiredoxin-5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prdx5-peroxiredoxin-5-protein-mouse-his.html

Purity

97.00

Smiles

MAPIKVGDAIPSVEVFEGEPGKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKALNVEPDGTGLTCSLAPNILSQL

Molecular Formula

54683 (Gene_ID) P99029-1 (M49-L210) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P45 NF-E2 Recombinant Antibody, PE Conjugated
bsm-62800R-PE-TR 20 µL

P45 NF-E2 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Anti-IGF2 (DX-2647) Biosimilar (Monoclonal, IgG)
A136405 100 µL

Anti-IGF2 (DX-2647) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
GSDMB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
22724111 3x 1.0 µg

GSDMB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Anti-CACNA2D2 Antibody Picoband®, FITC Conjugate
A01560-1-FITC 100 µg/Vial

Anti-CACNA2D2 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Rat Glucokinase/GCK ELISA Kit (Colorimetric)
NBP2-67982 1 Kit

Rat Glucokinase/GCK ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Grx5 CRISPR Activation Plasmid (h2)
sc-409931-ACT-2 20 µg

Grx5 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details