Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JOSD2, Human

The JOSD2 protein serves as an enzymatic entity capable of cleaving "Lys-63"-linked polyubiquitin chains and, to a lesser extent, "Lys-48"-linked polyubiquitin chains in vitro. This suggests its potential role as a deubiquitinating enzyme involved in the removal of specific ubiquitin linkages. JOSD2 Protein, Human is the recombinant human-derived JOSD2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

JOSD2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/josd2-protein-human.html

Smiles

SQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD

Molecular Formula

126119 (Gene_ID) Q8TAC2-1 (S2-D188) (Accession)

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SDHA Antibody
NBP2-93922-0.1mL 0.1 mL

Rabbit Polyclonal SDHA Antibody

Sign In for Pricing
View Details
Human C1orf150 (GCSAmL) activation kit by CRISPRa
GA115687 1 Kit

Human C1orf150 (GCSAmL) activation kit by CRISPRa

Sign In for Pricing
View Details
MCPH1, NT (MCPH1, Microcephalin) (FITC)
MBS6319763-01 0.2 mL

MCPH1, NT (MCPH1, Microcephalin) (FITC)

Sign In for Pricing
View Details
MCPH1, NT (MCPH1, Microcephalin) (FITC)
MBS6319763-02 5x 0.2 mL

MCPH1, NT (MCPH1, Microcephalin) (FITC)

Sign In for Pricing
View Details
Caspase 3 Rabbit Polyclonal Antibody
orb1289857-01 30 µL

Caspase 3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caspase 3 Rabbit Polyclonal Antibody
orb1289857-02 50 μL

Caspase 3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details