Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JOSD2, Human

The JOSD2 protein serves as an enzymatic entity capable of cleaving "Lys-63"-linked polyubiquitin chains and, to a lesser extent, "Lys-48"-linked polyubiquitin chains in vitro. This suggests its potential role as a deubiquitinating enzyme involved in the removal of specific ubiquitin linkages. JOSD2 Protein, Human is the recombinant human-derived JOSD2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

JOSD2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/josd2-protein-human.html

Smiles

SQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD

Molecular Formula

126119 (Gene_ID) Q8TAC2-1 (S2-D188) (Accession)

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CENPE Polyclonal Antibody
E915263 100 µL

CENPE Polyclonal Antibody

Sign In for Pricing
View Details
PQLC1 Rabbit Polyclonal Antibody (FITC)
orb2112411 100 µL

PQLC1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CD62L (L-Selectin) (LAM1-116), CF405S conjugate, 0.1mg/mL
BNC041587-100 1x 100 µL

CD62L (L-Selectin) (LAM1-116), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Grp94 monoclonal antibody (9G10) (PE conjugate)
ADI-SPA-850PE-D 50 µg

Grp94 monoclonal antibody (9G10) (PE conjugate)

Sign In for Pricing
View Details
KRTAP1-5 CRISPR/Cas9 KO Plasmid (h)
sc-418329 20 µg

KRTAP1-5 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Anti-OXR1 (Rabbit, Monoclonal)
A118098 100 µL

Anti-OXR1 (Rabbit, Monoclonal)

Sign In for Pricing
View Details