Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JOSD2, Human

The JOSD2 protein serves as an enzymatic entity capable of cleaving "Lys-63"-linked polyubiquitin chains and, to a lesser extent, "Lys-48"-linked polyubiquitin chains in vitro. This suggests its potential role as a deubiquitinating enzyme involved in the removal of specific ubiquitin linkages. JOSD2 Protein, Human is the recombinant human-derived JOSD2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

JOSD2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/josd2-protein-human.html

Smiles

SQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD

Molecular Formula

126119 (Gene_ID) Q8TAC2-1 (S2-D188) (Accession)

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Cytokeratin 8/18 Antibody (SPM192 + SPM265) [DyLight 405]
NBP3-08640V 100 µL

Mouse Monoclonal Cytokeratin 8/18 Antibody (SPM192 + SPM265) [DyLight 405]

Ask
View Details
Human Polyclonal Human IgA Kappa Isotype Control [DyLight 350]
NBP3-06873UV 0.1 mL

Human Polyclonal Human IgA Kappa Isotype Control [DyLight 350]

Ask
View Details
Recombinant Hydrastis canadensis Photosystem II reaction center protein T (psbT), partial
MBS7090488 Inquire

Recombinant Hydrastis canadensis Photosystem II reaction center protein T (psbT), partial

Ask
View Details
Human Importin alpha 2 Recombinant Protein N-6 His Tag
MBS8432537-01 0.05 mg

Human Importin alpha 2 Recombinant Protein N-6 His Tag

Ask
View Details
Human Importin alpha 2 Recombinant Protein N-6 His Tag
MBS8432537-02 5x 0.05 mg

Human Importin alpha 2 Recombinant Protein N-6 His Tag

Ask
View Details
ALF (GTF2A1L) Human shRNA Lentiviral Particle (Locus ID 11036)
TL315618V 500 µL Each

ALF (GTF2A1L) Human shRNA Lentiviral Particle (Locus ID 11036)

Ask
View Details