Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JOSD2, Human

The JOSD2 protein serves as an enzymatic entity capable of cleaving "Lys-63"-linked polyubiquitin chains and, to a lesser extent, "Lys-48"-linked polyubiquitin chains in vitro. This suggests its potential role as a deubiquitinating enzyme involved in the removal of specific ubiquitin linkages. JOSD2 Protein, Human is the recombinant human-derived JOSD2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

JOSD2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/josd2-protein-human.html

Smiles

SQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD

Molecular Formula

126119 (Gene_ID) Q8TAC2-1 (S2-D188) (Accession)

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASK rabbit pAb
E44H13450 100 µL

CASK rabbit pAb

Sign In for Pricing
View Details
Epac1/RAPGEF3 Rabbit Polyclonal Antibody (HRP)
orb2603827 100 µg

Epac1/RAPGEF3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
NIF3L1 Antibody
orb519908-01 50 μL

NIF3L1 Antibody

Sign In for Pricing
View Details
NIF3L1 Antibody
orb519908-02 100 µL

NIF3L1 Antibody

Sign In for Pricing
View Details
MLKL (Ser345) Recombinant Rabbit mAb, BF488 conjugated
orb2349673 100 µL

MLKL (Ser345) Recombinant Rabbit mAb, BF488 conjugated

Sign In for Pricing
View Details
anti-GALNTL1
YF-PA20188 50 ul

anti-GALNTL1

Sign In for Pricing
View Details