Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 Minor capsid protein L2 (L2), partial

Product Specifications

Abbreviation

Recombinant Human papillomavirus type 16 L2 protein, partial

Gene Name

L2

UniProt

P03107

Expression Region

68-473aa

Organism

Human papillomavirus type 16

Target Sequence

GRTGYIPLGTRPPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDAGAPTSVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAETGGHFTLSSSTISTHNYEEIPMDTFIVSTNPNTVTSSTPIPGSRPVARLGLYSRTTQQVKVVDPAFVTTPTKLITYDNPAYEGIDVDNTLYFSSNDNSINIAPDPDFLDIVALHRPALTSRRTGIRYSRIGNKQTLRTRSGKSIGAKVHYYYDLSTIDPAEEIELQTITPSTYTTTSHAASPTSINNGLYDIYADDFITDTSTTPVPSVPSTSLSGYIPANTTIPFGGAYNIPLVSGPDIPINITDQAPSLIPIVPGSPQYTIIADAGDFYLHPSYYMLRKRRKRLPYFFSDVSLAA

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Minor protein of the capsid that localizes along the inner surface of the virion, within the central cavities beneath the L1 pentamers. Plays a role in capsid stabilization through interaction with the major capsid protein L1. Once the virion enters the host cell, L2 escorts the genomic DNA into the nucleus by promoting escape from the endosomal compartments and traffic through the host Golgi network. Mechanistically, the C-terminus of L2 possesses a cell-penetrating peptide that protudes from the host endosome, interacts with host cytoplasmic retromer cargo and thereby mediates the capsid delivery to the host trans-Golgi network. Plays a role through its interaction with host dynein in the intracellular microtubule-dependent transport of viral capsid toward the nucleus. Mediates the viral genome import into the nucleus through binding to host importins. Once within the nucleus, L2 localizes viral genomes to host PML bodies in order to activate early gene expression for establishment of infection. Later on, promotes late gene expression by interacting with the viral E2 protein and by inhibiting its transcriptional activation functions. During virion assembly, encapsidates the genome by direct interaction with the viral DNA.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.7 kDa

References & Citations

Identification of the dynein light chains required for human papillomavirus infection.Schneider M.A., Spoden G.A., Florin L., Lambert C.Cell. Microbiol. 13:32-46 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Hamster C-reactive protein (CRP) ELISA Kit
YLA0032HA-01 48 Tests

Hamster C-reactive protein (CRP) ELISA Kit

Ask
View Details
Hamster C-reactive protein (CRP) ELISA Kit
YLA0032HA-02 96 Tests

Hamster C-reactive protein (CRP) ELISA Kit

Ask
View Details
Mouse Monoclonal Thrombomodulin/BDCA-3 Antibody (THBD/1782) [Alexa Fluor 647]
NBP2-54496AF647 100 µL

Mouse Monoclonal Thrombomodulin/BDCA-3 Antibody (THBD/1782) [Alexa Fluor 647]

Ask
View Details
EMP3 (NM_001425) Human Over-expression Lysate
LS002014-100ug 100 µg

EMP3 (NM_001425) Human Over-expression Lysate

Ask
View Details
COR (Cortisol) BioAssayTM ELISA Kit (Equine) discontinued
396377-01 48 Tests

COR (Cortisol) BioAssayTM ELISA Kit (Equine) discontinued

Ask
View Details
COR (Cortisol) BioAssayTM ELISA Kit (Equine) discontinued
396377-02 96 Tests

COR (Cortisol) BioAssayTM ELISA Kit (Equine) discontinued

Ask
View Details