Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TrkA, Canine (HEK293, Fc)

TrkA Protein (isoform 3) belongs to the nerve growth factor receptor family and can promote angiogenesis and has carcinogenic activity when overexpressed. TrkA Protein (isoform 3) antagonizes the anti-proliferative NGF-NTRK1 signaling that promotes the differentiation of neuronal precursors. TrkA Protein, Canine (HEK293, Fc) is the recombinant canine-derived TrkA protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

TrkA Protein, Canine (HEK293, Fc), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trka-protein-canine-hek293-fc.html

Purity

96.00

Smiles

PASVQLHEAVELHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPVANETVRHGCLRLNQPTHVNNGNYTLLAANPSGRAAAFVMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEK

Molecular Formula

490404 (Gene_ID) A0A8I3P078/XP_851619.3 (P285-K410) (Accession)

Molecular Weight

Approximately 58-75 kDa due to the glycosylation.

References & Citations

[1]Tacconelli A, et al. TrkA alternative splicing: a regulated tumor-promoting switch in human neuroblastoma[J]. Cancer cell, 2004, 6 (4) : 347-360.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D3 (TBC1D3F) (C-term) Rabbit Polyclonal Antibody
AP54171PU-N 400 µL

TBC1D3 (TBC1D3F) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL12A Antibody
KC-466-01 50 μL

IL12A Antibody

Sign In for Pricing
View Details
IL12A Antibody
KC-466-02 100 µL

IL12A Antibody

Sign In for Pricing
View Details
IL12A Antibody
KC-466-03 1 mL

IL12A Antibody

Sign In for Pricing
View Details
Arsa Mouse Gene Knockout Kit (CRISPR)
KN501623 1 Kit

Arsa Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant HLA-A Antibody
RC-15368-01 50 μL

Recombinant HLA-A Antibody

Sign In for Pricing
View Details