Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Profilin-2, Human (His)

Profilin-2 protein is a key player in protein folding. It specifically binds to cytosolic chaperone protein (c-CPN) and promotes the transfer of target proteins. It also interacts with nascent polypeptide chains, helping unnatural proteins fold correctly in various competing pathways. Profilin-2 Protein, Human (His) is the recombinant human-derived Profilin-2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Profilin-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/profilin-2-protein-human-his.html

Purity

95.0

Smiles

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Molecular Formula

5217 (Gene_ID) AAH18049.1 (M1-F140) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2E)-2-Hexylidenecyclopentanone
TRC-H296553-500MG 500 mg

(2E)-2-Hexylidenecyclopentanone

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2444), CF488A conjugate, 0.1mg/mL
BNC882444-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2444), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2425), CF740 conjugate, 0.1mg/mL
BNC742425-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2425), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tfeb Mouse Gene Knockout Kit (CRISPR)
KN517467 1 Kit

Tfeb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,3,3′,4,4′,5,5′,6-Octabromo-1,1′-biphenyl
TRC-O920010-50MG 50 mg

2,3,3′,4,4′,5,5′,6-Octabromo-1,1′-biphenyl

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB511125 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details