Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Profilin-2, Human (His)

Profilin-2 protein is a key player in protein folding. It specifically binds to cytosolic chaperone protein (c-CPN) and promotes the transfer of target proteins. It also interacts with nascent polypeptide chains, helping unnatural proteins fold correctly in various competing pathways. Profilin-2 Protein, Human (His) is the recombinant human-derived Profilin-2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Profilin-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/profilin-2-protein-human-his.html

Purity

95.0

Smiles

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Molecular Formula

5217 (Gene_ID) AAH18049.1 (M1-F140) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BECN1 Polyclonal Antibody
AN006940L-01 25 µL

BECN1 Polyclonal Antibody

Sign In for Pricing
View Details
BECN1 Polyclonal Antibody
AN006940L-02 100 µL

BECN1 Polyclonal Antibody

Sign In for Pricing
View Details
1X Phosphate Buffered Saline, pH8.0, Ultra Pure Grade, 1L
PB0315-1L 1 L

1X Phosphate Buffered Saline, pH8.0, Ultra Pure Grade, 1L

Sign In for Pricing
View Details
Syap1 Mouse Gene Knockout Kit (CRISPR)
KN517032 1 Kit

Syap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RTI-COC 31
TRC-R701120-50MG 50 mg

RTI-COC 31

Sign In for Pricing
View Details
Human RAP2C activation kit by CRISPRa
GA111742 1 Kit

Human RAP2C activation kit by CRISPRa

Sign In for Pricing
View Details