Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Profilin-2, Human (His)

Profilin-2 protein is a key player in protein folding. It specifically binds to cytosolic chaperone protein (c-CPN) and promotes the transfer of target proteins. It also interacts with nascent polypeptide chains, helping unnatural proteins fold correctly in various competing pathways. Profilin-2 Protein, Human (His) is the recombinant human-derived Profilin-2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Profilin-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/profilin-2-protein-human-his.html

Purity

95.0

Smiles

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Molecular Formula

5217 (Gene_ID) AAH18049.1 (M1-F140) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adssl1 Mouse Gene Knockout Kit (CRISPR)
KN300941BN 1 Kit

Adssl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (121-3), CF647 conjugate, 0.1mg/mL
BNC470945-100 1x 100 µL

Double Stranded DNA (dsDNA) (121-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMC4 (NM_001002800) Human Over-expression Lysate
LY424157 100 µg

SMC4 (NM_001002800) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Bop1 activation kit by CRISPRa
GA200435 1 Kit

Mouse Bop1 activation kit by CRISPRa

Sign In for Pricing
View Details
2,5-Dichlorophenol
TRC-D436105-25G 25 g

2,5-Dichlorophenol

Sign In for Pricing
View Details
Zfp638 Mouse Gene Knockout Kit (CRISPR)
KN519712 1 Kit

Zfp638 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details