Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Profilin-2, Human (His)

Profilin-2 protein is a key player in protein folding. It specifically binds to cytosolic chaperone protein (c-CPN) and promotes the transfer of target proteins. It also interacts with nascent polypeptide chains, helping unnatural proteins fold correctly in various competing pathways. Profilin-2 Protein, Human (His) is the recombinant human-derived Profilin-2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Profilin-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/profilin-2-protein-human-his.html

Purity

95.0

Smiles

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Molecular Formula

5217 (Gene_ID) AAH18049.1 (M1-F140) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), Biotin conjugate, 0.1mg/mL
BNCB1395-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 6 (MUC6) (MUC6/916), CF405S conjugate, 0.1mg/mL
BNC040916-500 1x 500 µL

Mucin 6 (MUC6) (MUC6/916), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRITC Conjugated Rabbit Polyclonal Antibody to Goat IgG
RA-2357-2 2 mL

TRITC Conjugated Rabbit Polyclonal Antibody to Goat IgG

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-500 1x 500 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
JMY (NM_152405) Human Over-expression Lysate
LY432410 100 µg

JMY (NM_152405) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human IL-6 Protein (Fc Tag)
PDMH100428-01 20 µg

Recombinant Human IL-6 Protein (Fc Tag)

Sign In for Pricing
View Details