Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Profilin-2, Human (His)

Profilin-2 protein is a key player in protein folding. It specifically binds to cytosolic chaperone protein (c-CPN) and promotes the transfer of target proteins. It also interacts with nascent polypeptide chains, helping unnatural proteins fold correctly in various competing pathways. Profilin-2 Protein, Human (His) is the recombinant human-derived Profilin-2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Profilin-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/profilin-2-protein-human-his.html

Purity

95.0

Smiles

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

Molecular Formula

5217 (Gene_ID) AAH18049.1 (M1-F140) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 Glycoprotein (CD59) Antibody
abx139307 0.1 mg

CD59 Glycoprotein (CD59) Antibody

Sign In for Pricing
View Details
IRS-1 (H-7) HRP
sc-515017 HRP 200 µg/mL

IRS-1 (H-7) HRP

Sign In for Pricing
View Details
CDKN2AIPNL Double Nickase Plasmid (h)
sc-413890-NIC 20 µg

CDKN2AIPNL Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Accs sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
11163114 3x 1.0 µg

Accs sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Plastin L (LCP1) (NM_002298) Human Over-expression Lysate
LS003936-20ug 20 µg

Plastin L (LCP1) (NM_002298) Human Over-expression Lysate

Sign In for Pricing
View Details
Myotrophin Human Recombinant (MTPN Human)
PT_41561-01 5 µg

Myotrophin Human Recombinant (MTPN Human)

Sign In for Pricing
View Details