Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant HDV Large delta antigen

Product Specifications

CAS Number

9000-83-3

UniProt

P0C6L6

Expression Region

1-214aa

Organism

Hepatitis delta virus genotype I (isolate Italian) (HDV)

Target Sequence

MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFPWDILFPADPPFSPQSCRPQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Field of Research

Others

Assay Type

Developed Protein

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC7A (NM_016596) Human Recombinant Protein
TP313214M 100 µg

HDAC7A (NM_016596) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Total RNA, Spleen
CR560454 5 µg

Tissue Total RNA, Spleen

Sign In for Pricing
View Details
FITC Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]
E-AB-F1226C-01 50 Tests

FITC Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]

Sign In for Pricing
View Details
FITC Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]
E-AB-F1226C-02 100 Tests

FITC Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]

Sign In for Pricing
View Details
FITC Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]
E-AB-F1226C-03 2x 100 Tests

FITC Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]

Sign In for Pricing
View Details
Flomoxef Sodium
TRC-F403000-500MG 500 mg

Flomoxef Sodium

Sign In for Pricing
View Details