Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Human (His)

Animal-Free IL-19 Protein, Human (His) is the recombinant human-derived animal-FreeIL-19 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-human-his.html

Purity

98.00

Smiles

MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA

Molecular Formula

29949 (Gene_ID) AAK91776.1 (L63-A215) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-5 R alpha/CD125 MAb (Clone 1036601)
MAB2531-SP 25 µg

Human IL-5 R alpha/CD125 MAb (Clone 1036601)

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 6a Antibody (rKRT6A/2100) [Alexa Fluor 532]
NBP3-08749AF532 100 µL

Mouse Monoclonal Cytokeratin 6a Antibody (rKRT6A/2100) [Alexa Fluor 532]

Sign In for Pricing
View Details
Human Complement 7,C7 ELISA Kit
CN-03714H2 48T

Human Complement 7,C7 ELISA Kit

Sign In for Pricing
View Details
Anti-Ly6A Antibody (2H276)
TMAB-08461-01 25 µL

Anti-Ly6A Antibody (2H276)

Sign In for Pricing
View Details
Anti-Ly6A Antibody (2H276)
TMAB-08461-02 50 μL

Anti-Ly6A Antibody (2H276)

Sign In for Pricing
View Details
Anti-Ly6A Antibody (2H276)
TMAB-08461-03 100 µL

Anti-Ly6A Antibody (2H276)

Sign In for Pricing
View Details