Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEV Protease, Tobacco etch virus (S2256N, C-His)

The TEV protease is critical in aphid transmission and has proteolytic activity that cleaves the Gly-Gly dipeptide at its C terminus. In addition to proteolysis, it interacts with virions and aphid stylets, which is critical for aphid transmission. TEV Protease Protein, Tobacco etch virus (S2256N, C-His) is the recombinant Virus-derived TEV Protease protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TEV Protease Protein, Tobacco etch virus (S2256N, C-His), Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protease-protein-tobacco-etch-virus-s2256n-c-his.html

Purity

97.50

Smiles

ESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQSLHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMNKPEEPFQPVKEATQLMNELVYSQ

Molecular Formula

1502321 (Gene_ID) NP_062908.1 (E2039-Q2279, S2256N) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-500 1x 500 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-500 1x 500 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
BNC682216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF594 conjugate, 0.1mg/mL
BNC942597-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF568 conjugate, 0.1mg/mL
BNC681409-100 1x 100 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/718), CF568 conjugate, 0.1mg/mL
BNC680718-500 1x 500 µL

HER-2 / CD340 (HRB2/718), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details