Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPO1/R-spondin-1, Mouse (189a.a, His)

RSPO1 activates the canonical Wnt signaling pathway by binding to the LGR4-6 receptor, triggering an increase in target gene expression. It inhibits ZNRF3, regulates the Wnt signaling pathway, and negatively regulates the TGF-β pathway. RSPO1/R-spondin-1 Protein, Mouse (189a.a, His) is the recombinant mouse-derived RSPO1/R-spondin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

RSPO1/R-spondin-1 Protein, Mouse (189a.a, His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rspo1-r-spondin-1-protein-mouse-189aa-his.html

Purity

96.50

Smiles

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQEALYLHKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFRKGSEERTRRVLHAPGGDHTTCSDTKETRKCTVRRTPCPEG

Molecular Formula

192199 (Gene_ID) Q9Z132 (S21-G209) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3α (G15) polyclonal antibody
orb642638-01 25 µL

GSK3α (G15) polyclonal antibody

Sign In for Pricing
View Details
GSK3α (G15) polyclonal antibody
orb642638-02 50 μL

GSK3α (G15) polyclonal antibody

Sign In for Pricing
View Details
GSK3α (G15) polyclonal antibody
orb642638-03 100 µL

GSK3α (G15) polyclonal antibody

Sign In for Pricing
View Details
GSK3α (G15) polyclonal antibody
orb642638-04 200 µL

GSK3α (G15) polyclonal antibody

Sign In for Pricing
View Details
MEIS2 Polyclonal Antibody, Cy5.5 Conjugated
bs-11885R-Cy5.5 100 µL

MEIS2 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
N6AMT2 Polyclonal Antibody, HRP Conjugated
A51062-050 50 µL

N6AMT2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details