Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trefoil factor 3 (Tff3)

Product Specifications

Product Name Alternative

(Intestinal trefoil factor) (mITF)

Abbreviation

Recombinant Mouse Tff3 protein

Gene Name

Tff3

UniProt

Q62395

Expression Region

23-81aa

Organism

Mus musculus (Mouse)

Target Sequence

ADYVGLSPSQCMVPANVRVDCGYPSVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CaMKII beta/gamma Peptide
AF9030-BP 1 mg

CaMKII beta/gamma Peptide

Sign In for Pricing
View Details
NFKB1 (Nuclear Factor NF-kappa-B p105 Subunit, DNA-binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 1, Nuclear Factor NF-kappa-B p50 Subunit, DKFZp686C01211, MGC54151) (MaxLight 490)
130338-ML490 100 µL

NFKB1 (Nuclear Factor NF-kappa-B p105 Subunit, DNA-binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 1, Nuclear Factor NF-kappa-B p50 Subunit, DKFZp686C01211, MGC54151) (MaxLight 490)

Sign In for Pricing
View Details
PER-3 Rabbit Polyclonal Antibody (BF405)
orb2416831 100 µL

PER-3 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Mouse Prrt2 Pre-designed siRNA Set A
SI111255A 1 Each

Mouse Prrt2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Mouse MMP9 Protein, C-His
MB945011-01 50 µg

Recombinant Mouse MMP9 Protein, C-His

Sign In for Pricing
View Details
Recombinant Mouse MMP9 Protein, C-His
MB945011-02 100 µg

Recombinant Mouse MMP9 Protein, C-His

Sign In for Pricing
View Details