Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Follistatin (FST)

Product Specifications

Product Name Alternative

(FS) (Activin-binding protein)

Abbreviation

Recombinant Horse FST protein

Gene Name

FST

UniProt

O62650

Expression Region

30-344aa

Organism

Equus caballus (Horse)

Target Sequence

GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCDNVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVNCPGSSTCVVDQTNNAYCVTCNRICPEPTSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSEEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Binds directly to activin and functions as an activin antagonist. Specific inhibitor of the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.9 kDa

References & Citations

"Molecular cloning of cDNA for equine follistatin and its gene expression in the reproductive tissues of the mare." Sugawara Y., Yamanouchi K., Naito K., Tachi C., Tojo H., Sawasaki T. J. Vet. Med. Sci. 61:201-207 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBL (G-Protein beta Subunit-like, Gable, Mammalian Lethal with SEC13 Protein 8, mLST8, LST8, MGC111011, Protein GbetaL, Target of Rapamycin Complex Subunit LST8, TORC Subunit LST8) (MaxLight 750)
MBS6478801-01 0.1 mL

GBL (G-Protein beta Subunit-like, Gable, Mammalian Lethal with SEC13 Protein 8, mLST8, LST8, MGC111011, Protein GbetaL, Target of Rapamycin Complex Subunit LST8, TORC Subunit LST8) (MaxLight 750)

Sign In for Pricing
View Details
GBL (G-Protein beta Subunit-like, Gable, Mammalian Lethal with SEC13 Protein 8, mLST8, LST8, MGC111011, Protein GbetaL, Target of Rapamycin Complex Subunit LST8, TORC Subunit LST8) (MaxLight 750)
MBS6478801-02 5x 0.1 mL

GBL (G-Protein beta Subunit-like, Gable, Mammalian Lethal with SEC13 Protein 8, mLST8, LST8, MGC111011, Protein GbetaL, Target of Rapamycin Complex Subunit LST8, TORC Subunit LST8) (MaxLight 750)

Sign In for Pricing
View Details
NOX1 Human Pre-designed siRNA Set A
HY-RS09457 1 Set

NOX1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
NAC1 Antibody
MBS8586399-01 0.1 mg

NAC1 Antibody

Sign In for Pricing
View Details
NAC1 Antibody
MBS8586399-02 0.1 mL (AF405L)

NAC1 Antibody

Sign In for Pricing
View Details
NAC1 Antibody
MBS8586399-03 0.1 mL (AF405S)

NAC1 Antibody

Sign In for Pricing
View Details