Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neisseria meningitidis serogroup B Factor H binding protein (fhbP)

Product Specifications

Product Name Alternative

FHbp; Genome-derived Neisseria antigen 1870; GNA1870; Lipoprotein 2086; LP2086

Abbreviation

Recombinant Neisseria meningitidis serogroup B fhbP protein

Gene Name

FhbP

UniProt

Q9JXV4

Expression Region

20-274aa

Organism

Neisseria meningitidis serogroup B (strain MC58)

Target Sequence

CSSGGGGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

A bacterial surface lipoprotein that binds host (human) complement factor H (fH, gene CFH), binding contributes to the avoidance of complement-mediated lysis by N.meningitidis. Binding of fH to the bacteria surface is independent of bacterial sialic acid moieties. fH binding affinity is high enough that it may sequester plasma fH, depleting its circulating levels and de-regulating complement in the host (Probable) . This protein induces high levels of bactericidal antibodies in mice.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Prolyl Endopeptidase (PREP) ELISA Kit
MBS9356813 Inquire

Fish Prolyl Endopeptidase (PREP) ELISA Kit

Sign In for Pricing
View Details
VDAC3 (Voltage-dependent Anion-selective Channel Protein 3, VDAC-3, hVDAC3, Outer Mitochondrial Membrane Protein Porin 3) (APC)
135228-APC 100 µL

VDAC3 (Voltage-dependent Anion-selective Channel Protein 3, VDAC-3, hVDAC3, Outer Mitochondrial Membrane Protein Porin 3) (APC)

Sign In for Pricing
View Details
CCDC102B Polyclonal Antibody
RA22873-01 50 µL

CCDC102B Polyclonal Antibody

Sign In for Pricing
View Details
CCDC102B Polyclonal Antibody
RA22873-02 100 µL

CCDC102B Polyclonal Antibody

Sign In for Pricing
View Details
Bovine Epidermal basement membrane zone (EBMZ) ELISA Kit
NSL0185Bo 96 Tests

Bovine Epidermal basement membrane zone (EBMZ) ELISA Kit

Sign In for Pricing
View Details
CD5L Polyclonal Antibody
RA31503-01 50 µL

CD5L Polyclonal Antibody

Sign In for Pricing
View Details