Animal-Free IL-4, Human (His)
The IL-4 protein is primarily secreted by mast cells, T cells, eosinophils, and basophils and is critical for antibody production, hematopoiesis, and immune responses. It induces MHC class II expression on B cells, enhances IgE and IgG1 secretion, and modulates CD23 and IL31RA expression. Animal-Free IL-4 Protein, Human (His) is the recombinant human-derived animal-FreeIL-4 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-4 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-4-protein-human-his.html
Purity
98.0
Smiles
MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Molecular Formula
3565 (Gene_ID) P05112-1 (H25-S153) (Accession)
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Lentiviral mouse Calm5 shRNA (UAS) - Lentiviral mouse Calm5 shRNA (UAS, iRFP) plasmid
Recombinant Human Eukaryotic Translation Elongation Factor 1 Delta (EEF1d)