Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL24/Eotaxin-2, Rat

CCL24/Eotaxin-2 Protein, Rat is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Rat is a recombinant rat CCL24/Eotaxin-2 (V27-V119) protein expressed by E. coli[1].

Product Specifications

Product Name Alternative

CCL24/Eotaxin-2 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl24-eotaxin-2-protein-rat-93aa.html

Purity

95.0

Smiles

VTIPSSCCVTFISKKIPVNRVISYQLANGSICPKAGVIFITKKGHKICTDPKLPWVQKHIKNLDAKRNQPSEGAKALGPKFVIQKLRGNSTKV

Molecular Formula

288593 (Gene_ID) Q5PPP2 (V27-V119) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hui Li, et al. Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy. Int J Clin Exp Pathol. 2013 May 15;6 (6) :1028-37.|[2]Michal Segal-Salto, et al. A blocking monoclonal antibody to CCL24 alleviates liver fibrosis and inflammation in experimental models of liver damage. JHEP Rep. 2020 Jan 2;2 (1) :100064.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectropho Pot Dichro A/T Std 60mg/L in Cuvs - PK2
RSPEC0024 2 / PCK

Spectropho Pot Dichro A/T Std 60mg/L in Cuvs - PK2

Sign In for Pricing
View Details
INVS Antibody
E51A07115 100 µL

INVS Antibody

Sign In for Pricing
View Details
DND1 Antibody
47071 100 µL

DND1 Antibody

Sign In for Pricing
View Details
SETD6 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV684371 1.0 µg DNA

SETD6 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Aeromonas Hydrophila UPF0102 AHA_3896 Protein
VAng-Lsx0715-1mgEcoli 1 mg (E. coli)

Recombinant Aeromonas Hydrophila UPF0102 AHA_3896 Protein

Sign In for Pricing
View Details
BMS-833923
A3258-10 10 mg

BMS-833923

Sign In for Pricing
View Details