Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cystatin F/CST7, Human (HEK293, His)

Cystatin F/CST7 is a protein that acts as an inhibitor of papain and cathepsin L, but with lower affinity than other cystatins. It plays a potential role in immunomodulation by targeting specific components within the hematopoietic system. Cystatin F/CST7 Protein, Human (HEK293, His) is the recombinant human-derived Cystatin F/CST7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Cystatin F/CST7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cystatin-f-cst7-protein-human-hek-293-his.html

Purity

99.90

Smiles

GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH

Molecular Formula

8530 (Gene_ID) O76096 (G20-H145) (Accession)

Molecular Weight

19-25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-500 1x 500 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-500 1x 500 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details