Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free FGF-11 isoform 1, Human (His)

The FGF-11 isoform 1 protein is thought to play an important role in the development and function of the nervous system. Its presence indicates involvement in complex processes responsible for establishing and maintaining neural structure and activity. Animal-Free FGF-11 isoform 1 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-11 isoform 1 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free FGF-11 isoform 1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-fgf-11-isoform-1-protein-human-his.html

Purity

98.0

Smiles

MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP

Molecular Formula

2256 (Gene_ID) Q92914 (M1-P225) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCmL1 (NM_001037540) Human Tagged ORF Clone Lentiviral Particle
RC212954L3V 200 µL

SCmL1 (NM_001037540) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TA-Luc Control for Neomycin-GFP Luciferase Vectors (LR-2XXXN)
LR-2200N 1 Each

TA-Luc Control for Neomycin-GFP Luciferase Vectors (LR-2XXXN)

Sign In for Pricing
View Details
Anti-NUBPL antibody
PAab05889 100 µg

Anti-NUBPL antibody

Sign In for Pricing
View Details
Anti-Alkaline Phosphatase antibody
STJ16100829 100 µg

Anti-Alkaline Phosphatase antibody

Sign In for Pricing
View Details
Ethyl 1- (2-hydroxyethyl) piperidine-4-carboxylate
OR1064296-01 250 mg

Ethyl 1- (2-hydroxyethyl) piperidine-4-carboxylate

Sign In for Pricing
View Details
Ethyl 1- (2-hydroxyethyl) piperidine-4-carboxylate
OR1064296-02 1 g

Ethyl 1- (2-hydroxyethyl) piperidine-4-carboxylate

Sign In for Pricing
View Details