Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSTN, Cat (HEK293, His)

MSTN (Myostatin) serves as a dedicated negative regulator of skeletal muscle growth, forming homodimers through disulfide linkages. It inhibits WFIKKN2 activity through interaction and further contributes to its role in negatively modulating skeletal muscle growth by engaging with FSTL3. MSTN Protein, Cat (HEK293, His) is the recombinant cat-derived MSTN protein, expressed by HEK293 , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

MSTN Protein, Cat (HEK293, His), Cat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mstn-protein-cat-hek293-his.html

Purity

90.00

Smiles

GPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

101081322 (Gene_ID) M3WPT7 (G19-S375) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WARS Antibody, FITC conjugated
A38383-100UL 100 µL

WARS Antibody, FITC conjugated

Sign In for Pricing
View Details
SLC39A11 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV694471 1.0 µg DNA

SLC39A11 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Complement Factor H (CFH) Rabbit ELISA Kit
C3062 96 Tests

Complement Factor H (CFH) Rabbit ELISA Kit

Sign In for Pricing
View Details
Glutathione Peroxidase Activity Colorimetric Microplate Assay Kit
CAK1149 100 Assays

Glutathione Peroxidase Activity Colorimetric Microplate Assay Kit

Sign In for Pricing
View Details
MYF5 Antibody
A29197-50UG 50 µg

MYF5 Antibody

Sign In for Pricing
View Details
Influenza A H3N2 (A/swine/Colorado/A01203748/2012) Hemagglutinin/HA HEK293 Cell Lysate (WB positive control)
MBS8116219-01 0.3 mg

Influenza A H3N2 (A/swine/Colorado/A01203748/2012) Hemagglutinin/HA HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details