Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSTN, Cat (HEK293, His)

MSTN (Myostatin) serves as a dedicated negative regulator of skeletal muscle growth, forming homodimers through disulfide linkages. It inhibits WFIKKN2 activity through interaction and further contributes to its role in negatively modulating skeletal muscle growth by engaging with FSTL3. MSTN Protein, Cat (HEK293, His) is the recombinant cat-derived MSTN protein, expressed by HEK293 , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

MSTN Protein, Cat (HEK293, His), Cat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mstn-protein-cat-hek293-his.html

Purity

90.00

Smiles

GPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

101081322 (Gene_ID) M3WPT7 (G19-S375) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Fibroblast growth factor-binding protein 1 ELISA Kit
MBS2886635-01 48 Well

Rat Fibroblast growth factor-binding protein 1 ELISA Kit

Sign In for Pricing
View Details
Rat Fibroblast growth factor-binding protein 1 ELISA Kit
MBS2886635-02 96 Well

Rat Fibroblast growth factor-binding protein 1 ELISA Kit

Sign In for Pricing
View Details
Rat Fibroblast growth factor-binding protein 1 ELISA Kit
MBS2886635-03 5x 96 Well

Rat Fibroblast growth factor-binding protein 1 ELISA Kit

Sign In for Pricing
View Details
Rat Fibroblast growth factor-binding protein 1 ELISA Kit
MBS2886635-04 10x 96 Well

Rat Fibroblast growth factor-binding protein 1 ELISA Kit

Sign In for Pricing
View Details
NET1 Rabbit Polyclonal Antibody
TA340085 100 µL

NET1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal DZIP1 Antibody [DyLight 680]
NBP2-99579FR 0.1 mL

Rabbit Polyclonal DZIP1 Antibody [DyLight 680]

Sign In for Pricing
View Details