Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSTN, Cat (HEK293, His)

MSTN (Myostatin) serves as a dedicated negative regulator of skeletal muscle growth, forming homodimers through disulfide linkages. It inhibits WFIKKN2 activity through interaction and further contributes to its role in negatively modulating skeletal muscle growth by engaging with FSTL3. MSTN Protein, Cat (HEK293, His) is the recombinant cat-derived MSTN protein, expressed by HEK293 , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

MSTN Protein, Cat (HEK293, His), Cat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mstn-protein-cat-hek293-his.html

Purity

90.00

Smiles

GPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

101081322 (Gene_ID) M3WPT7 (G19-S375) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RXFP3/RLN3R1/SALPR Antibody [CoraFluor 1]
NBP2-97628CL1 0.1 mL

Rabbit Polyclonal RXFP3/RLN3R1/SALPR Antibody [CoraFluor 1]

Sign In for Pricing
View Details
TSNAX sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2540906 1.0 µg DNA

TSNAX sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
TTLL4 Human qPCR Primer Pair (NM_014640)
HP211034 200 Reactions

TTLL4 Human qPCR Primer Pair (NM_014640)

Sign In for Pricing
View Details
(4S) - (3’,4’-Dichlorophenyl) -3,4-dihydro-1,2-epoxy-1-O-triethylsilyl-1-naphthol
009241 10 mg

(4S) - (3’,4’-Dichlorophenyl) -3,4-dihydro-1,2-epoxy-1-O-triethylsilyl-1-naphthol

Sign In for Pricing
View Details
Ajap1 (NM_001101014) Rat Tagged ORF Clone Lentiviral Particle
RR205415L4V 200 µL

Ajap1 (NM_001101014) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Csn2 shRNA (UAS) - Lentiviral mouse Csn2 shRNA (UAS, RFP) (100)
GTR15138408 1 Vial

Lentiviral mouse Csn2 shRNA (UAS) - Lentiviral mouse Csn2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details