Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSTN, Cat (HEK293, His)

MSTN (Myostatin) serves as a dedicated negative regulator of skeletal muscle growth, forming homodimers through disulfide linkages. It inhibits WFIKKN2 activity through interaction and further contributes to its role in negatively modulating skeletal muscle growth by engaging with FSTL3. MSTN Protein, Cat (HEK293, His) is the recombinant cat-derived MSTN protein, expressed by HEK293 , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

MSTN Protein, Cat (HEK293, His), Cat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mstn-protein-cat-hek293-his.html

Purity

90.00

Smiles

GPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

101081322 (Gene_ID) M3WPT7 (G19-S375) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlamydia trachomatis Antibody (EB)
GWB-412D71 1 mL

Chlamydia trachomatis Antibody (EB)

Sign In for Pricing
View Details
anti-KIAA1199
YF-PA20160 50 ug

anti-KIAA1199

Sign In for Pricing
View Details
CD51 (Integrin alphaV, Vitronectin alpha Subunit Receptor, VNR)
MBS6507188-01 0.1 mL

CD51 (Integrin alphaV, Vitronectin alpha Subunit Receptor, VNR)

Sign In for Pricing
View Details
CD51 (Integrin alphaV, Vitronectin alpha Subunit Receptor, VNR)
MBS6507188-02 5x 0.1 mL

CD51 (Integrin alphaV, Vitronectin alpha Subunit Receptor, VNR)

Sign In for Pricing
View Details
BNIP3P CRISPRa sgRNA lentivector (set of three targets)(Human)
53383121 3x 1.0µg DNA

BNIP3P CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
NCF4 Mouse Monoclonal Antibody [Clone ID: OTI6H9]
TA809224S 30 µL

NCF4 Mouse Monoclonal Antibody [Clone ID: OTI6H9]

Sign In for Pricing
View Details