Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSTN, Cat (HEK293, His)

MSTN (Myostatin) serves as a dedicated negative regulator of skeletal muscle growth, forming homodimers through disulfide linkages. It inhibits WFIKKN2 activity through interaction and further contributes to its role in negatively modulating skeletal muscle growth by engaging with FSTL3. MSTN Protein, Cat (HEK293, His) is the recombinant cat-derived MSTN protein, expressed by HEK293 , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

MSTN Protein, Cat (HEK293, His), Cat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mstn-protein-cat-hek293-his.html

Purity

90.00

Smiles

GPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

101081322 (Gene_ID) M3WPT7 (G19-S375) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FLJ23356 (SGK196, Probable Inactive Protein Kinase-like Protein SgK196, Sugen Kinase 196, MGC126597) (MaxLight 750)
MBS6232882-01 0.1 mL

FLJ23356 (SGK196, Probable Inactive Protein Kinase-like Protein SgK196, Sugen Kinase 196, MGC126597) (MaxLight 750)

Ask
View Details
FLJ23356 (SGK196, Probable Inactive Protein Kinase-like Protein SgK196, Sugen Kinase 196, MGC126597) (MaxLight 750)
MBS6232882-02 5x 0.1 mL

FLJ23356 (SGK196, Probable Inactive Protein Kinase-like Protein SgK196, Sugen Kinase 196, MGC126597) (MaxLight 750)

Ask
View Details
RIO Kinase 3 (RIOK3, Serine/threonine-protein Kinase RIO3, SudD Homolog, SUDD) (MaxLight 550)
132599-ML550 100 µL

RIO Kinase 3 (RIOK3, Serine/threonine-protein Kinase RIO3, SudD Homolog, SUDD) (MaxLight 550)

Ask
View Details
Chicken anti-calmodulin specific antibody (CaM-ab) ELISA Kit
MBS267111-01 48 Well

Chicken anti-calmodulin specific antibody (CaM-ab) ELISA Kit

Ask
View Details
Chicken anti-calmodulin specific antibody (CaM-ab) ELISA Kit
MBS267111-02 96 Well

Chicken anti-calmodulin specific antibody (CaM-ab) ELISA Kit

Ask
View Details
Chicken anti-calmodulin specific antibody (CaM-ab) ELISA Kit
MBS267111-03 5x 96 Well

Chicken anti-calmodulin specific antibody (CaM-ab) ELISA Kit

Ask
View Details