Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSTN, Cat (HEK293, His)

MSTN (Myostatin) serves as a dedicated negative regulator of skeletal muscle growth, forming homodimers through disulfide linkages. It inhibits WFIKKN2 activity through interaction and further contributes to its role in negatively modulating skeletal muscle growth by engaging with FSTL3. MSTN Protein, Cat (HEK293, His) is the recombinant cat-derived MSTN protein, expressed by HEK293 , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

MSTN Protein, Cat (HEK293, His), Cat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mstn-protein-cat-hek293-his.html

Purity

90.00

Smiles

GPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Molecular Formula

101081322 (Gene_ID) M3WPT7 (G19-S375) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

14 3 3 eta (YWHAH) (NM_003405) Human Over-expression Lysate
LH06681V 100 µg

14 3 3 eta (YWHAH) (NM_003405) Human Over-expression Lysate

Ask
View Details
Polyclonal Anti- IL-4 Antibody
GWB-BBP303 0.1 mg

Polyclonal Anti- IL-4 Antibody

Ask
View Details
Recombinant Ostreococcus tauri Photosystem I reaction center subunit IX (psaJ), partial
MBS1280592-01 0.5 mg (E-Coli)

Recombinant Ostreococcus tauri Photosystem I reaction center subunit IX (psaJ), partial

Ask
View Details
Recombinant Ostreococcus tauri Photosystem I reaction center subunit IX (psaJ), partial
MBS1280592-02 0.05 mg (Baculovirus)

Recombinant Ostreococcus tauri Photosystem I reaction center subunit IX (psaJ), partial

Ask
View Details
Recombinant Ostreococcus tauri Photosystem I reaction center subunit IX (psaJ), partial
MBS1280592-03 0.5 mg (Yeast)

Recombinant Ostreococcus tauri Photosystem I reaction center subunit IX (psaJ), partial

Ask
View Details
Recombinant Ostreococcus tauri Photosystem I reaction center subunit IX (psaJ), partial
MBS1280592-04 0.05 mg (Mammalian-Cell)

Recombinant Ostreococcus tauri Photosystem I reaction center subunit IX (psaJ), partial

Ask
View Details