CIB2, Human (His, solution)
CIB2 protein: Calcium and integrin-binding protein involved in intracellular calcium regulation, auditory hair cell mechanotransduction, and maintenance of stereocilia bundle morphology. CIB2 Protein, Human (His, solution) is the recombinant human-derived CIB2, expressed by E. coli, with N-6*His labeled tag.
Product Specifications
Product Name Alternative
CIB2 Protein, Human (His, solution), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cib2-protein-human-n-his.html
Purity
98.0
Smiles
MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI
Molecular Formula
10518 (Gene_ID) O75838-1 (M1-I187) (Accession)
Molecular Weight
Approximately 25 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1261326-01 0.02 mg (Yeast)
Recombinant Mouse H-2 class I histocompatibility antigen, D-D alpha chain (H2-D1), partial
Sign In for Pricing
View Details MBS1261326-02 0.02 mg (E-Coli)
Recombinant Mouse H-2 class I histocompatibility antigen, D-D alpha chain (H2-D1), partial
Sign In for Pricing
View Details MBS1261326-03 0.1 mg (Yeast)
Recombinant Mouse H-2 class I histocompatibility antigen, D-D alpha chain (H2-D1), partial
Sign In for Pricing
View Details MBS1261326-04 0.1 mg (E-Coli)
Recombinant Mouse H-2 class I histocompatibility antigen, D-D alpha chain (H2-D1), partial
Sign In for Pricing
View Details MBS1261326-05 1 mg (E-Coli)
Recombinant Mouse H-2 class I histocompatibility antigen, D-D alpha chain (H2-D1), partial
Sign In for Pricing
View Details