Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIB2, Human (His, solution)

CIB2 protein: Calcium and integrin-binding protein involved in intracellular calcium regulation, auditory hair cell mechanotransduction, and maintenance of stereocilia bundle morphology. CIB2 Protein, Human (His, solution) is the recombinant human-derived CIB2, expressed by E. coli, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CIB2 Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cib2-protein-human-n-his.html

Purity

98.0

Smiles

MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI

Molecular Formula

10518 (Gene_ID) O75838-1 (M1-I187) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine GPX4/Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial ELISA Kit
MBS2891265-01 48 Well

Bovine GPX4/Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Bovine GPX4/Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial ELISA Kit
MBS2891265-02 96 Well

Bovine GPX4/Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Bovine GPX4/Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial ELISA Kit
MBS2891265-03 5x 96 Well

Bovine GPX4/Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Bovine GPX4/Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial ELISA Kit
MBS2891265-04 10x 96 Well

Bovine GPX4/Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
KIAA1012 Protein Vector (Human) (pPB-N-His)
PV053778 500 ng

KIAA1012 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Human LINC01312 qPCR Primer Pair
QH65833S 200 Tests

Human LINC01312 qPCR Primer Pair

Sign In for Pricing
View Details