Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIB2, Human (His, solution)

CIB2 protein: Calcium and integrin-binding protein involved in intracellular calcium regulation, auditory hair cell mechanotransduction, and maintenance of stereocilia bundle morphology. CIB2 Protein, Human (His, solution) is the recombinant human-derived CIB2, expressed by E. coli, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CIB2 Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cib2-protein-human-n-his.html

Purity

98.0

Smiles

MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI

Molecular Formula

10518 (Gene_ID) O75838-1 (M1-I187) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gm10639 shRNA (UAS) - Lentiviral mouse Gm10639 shRNA (UAS, GFP) (100)
GTR15214593 1 Vial

Lentiviral mouse Gm10639 shRNA (UAS) - Lentiviral mouse Gm10639 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
BDNF Recombinant Rabbit mAb, BF750 conjugated
orb2352909 100 µL

BDNF Recombinant Rabbit mAb, BF750 conjugated

Sign In for Pricing
View Details
CCL8 Antibody (HRP)
KH-2841-01 50 μL

CCL8 Antibody (HRP)

Sign In for Pricing
View Details
CCL8 Antibody (HRP)
KH-2841-02 100 µL

CCL8 Antibody (HRP)

Sign In for Pricing
View Details
CCL8 Antibody (HRP)
KH-2841-03 1 mL

CCL8 Antibody (HRP)

Sign In for Pricing
View Details
Ccr1 (NM_009912) Mouse Tagged ORF Clone
MR205412 10 µg

Ccr1 (NM_009912) Mouse Tagged ORF Clone

Sign In for Pricing
View Details