Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fibrillin-1/Asprosin, Mouse (HEK293, His)

Fibrillin-1/Asprosin proteins play crucial roles in a variety of biological processes. They regulate osteoblast maturation by controlling the availability of TGF-β and regulating TGF-β and BMP levels. Fibrillin-1/Asprosin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fibrillin-1/Asprosin protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Fibrillin-1/Asprosin Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fibrillin-1-asprosin-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

STNETDASDIQDGSEMEANVSLASWDVEKPASFAFNISHVNNKVRILELLPALTTLMNHNRYLIESGNEDGFFKINQKEGVSYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH

Molecular Formula

14118 (Gene_ID) Q61554 (S2734-H2873) (Accession)

Molecular Weight

Approximately 27-34 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Fc gamma RIIA/CD32a Antibody (020) [Alexa Fluor 405]
NBP2-89456AF405 0.1 mL

Rabbit Monoclonal Fc gamma RIIA/CD32a Antibody (020) [Alexa Fluor 405]

Sign In for Pricing
View Details
Mouse Anti-Rat IgG Antibody (H+L), PerCP Conjugated
bs-0293M-PerCP 200 µL

Mouse Anti-Rat IgG Antibody (H+L), PerCP Conjugated

Sign In for Pricing
View Details
Human Advanced Glycosylation End Product Specific Receptor (AGER) Antibody Pair Kit (with Standard)
MBS2099247-01 5x 96 Tests

Human Advanced Glycosylation End Product Specific Receptor (AGER) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Advanced Glycosylation End Product Specific Receptor (AGER) Antibody Pair Kit (with Standard)
MBS2099247-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Advanced Glycosylation End Product Specific Receptor (AGER) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Advanced Glycosylation End Product Specific Receptor (AGER) Antibody Pair Kit (with Standard)
MBS2099247-03 10x 96 Tests

Human Advanced Glycosylation End Product Specific Receptor (AGER) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Advanced Glycosylation End Product Specific Receptor (AGER) Antibody Pair Kit (with Standard)
MBS2099247-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Advanced Glycosylation End Product Specific Receptor (AGER) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details