Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Dipeptidase 3 (Dpep3)

Product Specifications

Product Name Alternative

Membrane-bound dipeptidase 3; MBD-3; Protein expressed in male leptotene and zygotene spermatocytes 136; MLZ-136

Abbreviation

Recombinant Mouse Dpep3 protein

Gene Name

Dpep3

UniProt

Q9DA79

Expression Region

36-462aa

Organism

Mus musculus (Mouse)

Target Sequence

TCTLTTPSPSSAPTTPEASNATTAPGIPNDTATSGVTSDPRLREQALALMRDFPLVDGHNDLPLLLRELFQNQLQDVNLRNFTRGQTNLDRLRDGLVGAQFWSAYIPCQTQDRDAVRLALEQIDLIRRMCSAYPELELVTSADGLNNTQKLACLIGVEGGHSLDTSLAVLRSFYELGVRYLTLTFTCSTPWAESATKFRHHFYTNISGLTSFGEKVVEEMNRLGMMIDLSHASDTLVKQTLEVSQAPVIFSHSAARSVCDNLLNIPDDILQLLKKNGGIVMVTLSMGVLQCSLFANVSTVADHFDHIRTVIGSEFIGIGGSYDGSGRFPQGLEDVSTYPVLIEELLSRGWDERELQGVLRGNLLRVFRQVEQVREKSLGQSPVEVKFPERQQSNTCHSHLLPQPQEDQHQDTHLKVTKLPNILQRAS

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cell Biology

Relevance

Lacks dipeptidase activity and is unable to hydrolyze cystinyl-bis-glycine. The absence of activity may be due to the inability of serine (instead of aspartate found in DPEP1/2) at position 356 to function as the acid/base catalyst and activate the nucleophilic water/hydroxide. Does not hydrolyze leukotriene D4 (LTD4) into leukotriene E4 (LTE4) . Does not hydrolyze the beta-lactam antibiotic imipenem.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFluor™ 633 succinimidyl ester
1510-AAT 1 mg

ZFluor™ 633 succinimidyl ester

Sign In for Pricing
View Details
Protonex™ Red 600-Latex Bead Conjugate
21209-AAT 1 mL

Protonex™ Red 600-Latex Bead Conjugate

Sign In for Pricing
View Details
Nimotuzumab Biosimilar - Research Grade
ICH4008-50mg 50 mg

Nimotuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
1-Ethylpyrrole
TRC-E925693-500MG 500 mg

1-Ethylpyrrole

Sign In for Pricing
View Details
SIRP alpha Antibody
KC-1075-01 50 μL

SIRP alpha Antibody

Sign In for Pricing
View Details
SIRP alpha Antibody
KC-1075-02 100 µL

SIRP alpha Antibody

Sign In for Pricing
View Details