DYDC2, Human (His)
DYDC2, or Dpy-30 domain-containing protein 2, is a member of the dpy-30 family. DYDC2 Protein, Human (GST) is the recombinant human-derived DYDC2 protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
DYDC2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/dydc2-protein-human-gst.html
Purity
98.0
Smiles
TIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSP
Molecular Formula
84332 (Gene_ID) Q96IM9 (T102-P176) (Accession)
Molecular Weight
Approximately 37 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx069627-01 50 µg
Dog Vascular Cell Adhesion Molecule 1 (VCAM1) Protein
Sign In for Pricing
View Details abx069627-02 100 µg
Dog Vascular Cell Adhesion Molecule 1 (VCAM1) Protein
Sign In for Pricing
View Details abx069627-03 200 µg
Dog Vascular Cell Adhesion Molecule 1 (VCAM1) Protein
Sign In for Pricing
View Details abx069627-04 500 µg
Dog Vascular Cell Adhesion Molecule 1 (VCAM1) Protein
Sign In for Pricing
View Details abx069627-05 1 mg
Dog Vascular Cell Adhesion Molecule 1 (VCAM1) Protein
Sign In for Pricing
View Details 
MBS1436424-01 0.02 mg (E-Coli)
Recombinant Ehrlichia ruminantium 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr)
Sign In for Pricing
View Details