DYDC2, Human (His)
DYDC2, or Dpy-30 domain-containing protein 2, is a member of the dpy-30 family. DYDC2 Protein, Human (GST) is the recombinant human-derived DYDC2 protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
DYDC2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/dydc2-protein-human-gst.html
Purity
98.0
Smiles
TIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSP
Molecular Formula
84332 (Gene_ID) Q96IM9 (T102-P176) (Accession)
Molecular Weight
Approximately 37 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx01529-1mgEcoli 1 mg (E. coli)
Recombinant Clostridium Tetani atpB1 Protein (aa 1-461)
Sign In for Pricing
View Details ![Rabbit Polyclonal JPH1 Antibody [mFluor Violet 450 SE]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP1-77338MFV450 0.1 mL
Rabbit Polyclonal JPH1 Antibody [mFluor Violet 450 SE]
Sign In for Pricing
View Details MBS6235907-01 0.1 mL
TSC22D1 (TSC22 Domain Family Protein 1, Cerebral Protein 2, hucep-2, KIAA1994, MGC17597, Regulatory Protein TSC-22, TGFB-stimulated Clone 22 Homolog, Transforming Growth Factor beta-1-induced Transcript 4 Protein, TGFB1I4, TSC22, DKFZp686O19206, MGC17597,
Sign In for Pricing
View Details MBS6235907-02 5x 0.1 mL
TSC22D1 (TSC22 Domain Family Protein 1, Cerebral Protein 2, hucep-2, KIAA1994, MGC17597, Regulatory Protein TSC-22, TGFB-stimulated Clone 22 Homolog, Transforming Growth Factor beta-1-induced Transcript 4 Protein, TGFB1I4, TSC22, DKFZp686O19206, MGC17597,
Sign In for Pricing
View Details