Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR9, Human (GST)

CCR9 Protein, a receptor for SCYA25/TECK, activates signaling, elevating intracellular calcium ions. In microbial infection, it acts as an alternative HIV-1 coreceptor with CD4, influencing the infection process. CCR9 Protein, Human (GST) is the recombinant human-derived CCR9 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CCR9 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccr9-protein-human-gst.html

Purity

90.00

Smiles

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFAS

Molecular Formula

10803 (Gene_ID) P51686-1 (M1-S48) (Accession)

Molecular Weight

33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD62E (SELE) (NM_000450) Human Over-expression Lysate
LC400158 20 µg

CD62E (SELE) (NM_000450) Human Over-expression Lysate

Sign In for Pricing
View Details
Human A4GNT activation kit by CRISPRa
GA109604 1 Kit

Human A4GNT activation kit by CRISPRa

Sign In for Pricing
View Details
Aflatoxin B2-d3
TRC-A357467-2.5MG 2.5 mg

Aflatoxin B2-d3

Sign In for Pricing
View Details
CLK1 (N-term) Rabbit Polyclonal Antibody
AP14159PU-N 400 µL

CLK1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
L-Praziquanamine
TRC-P702090-50MG 50 mg

L-Praziquanamine

Sign In for Pricing
View Details
NDRG1 (NM_001135242) Human Over-expression Lysate
LY427604 100 µg

NDRG1 (NM_001135242) Human Over-expression Lysate

Sign In for Pricing
View Details