CTXB, Vibrio cholerae
Product Specifications
UNSPSC Description
The pentameric ring of the B subunit of the CTXB protein guides the A subunit by binding to GM1 ganglioside on intestinal epithelial cells. This loop binds five GM1 gangliosides and promotes the specific interaction of the toxin with its cellular receptor. CTXB Protein, Vibrio cholerae is the recombinant CTXB protein, expressed by E. coli , with tag free. The total length of CTXB Protein, Vibrio cholerae is 103 a.a., with molecular weight of ~11.0 kDa.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ctxb-protein-vibrio-cholerae.html
Purity
98.0
Smiles
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Molecular Weight
Approximately 11.0 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC611224-100 1x 100 µL
HCG-beta (HCGb/54+ HCGb/459), CF660R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040764-100 1x 100 µL
CD79a (IGA/764), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680757-100 1x 100 µL
Cytokeratin 7 (K72.7), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941120-500 1x 500 µL
Ep-CAM / CD326 (EGP40/1120), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681788-500 1x 500 µL
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740261-100 1x 100 µL
CD66 (CEA) (C66/261), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details