Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICOS Protein, Mouse (C137S, C138S, HEK293, Fc)

ICOS proteins optimize T cell responses to foreign antigens, promoting proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and efficient B cell antibody secretion. ICOS is essential for efficient communication of T cells and B cells and for normal antibody responses to T cell-dependent antigens. ICOS Protein, Mouse (C137S, C138S, HEK293, Fc) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag and C137S, C138S mutation.

Product Specifications

Product Name Alternative

ICOS Protein, Mouse (C137S, C138S, HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/icos-protein-mouse-c137s-c138s-hek293-fc.html

Purity

95.00

Smiles

EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLSSQLKLWL

Molecular Formula

54167 (Gene_ID) Q9WVS0 (E21-L144, C137S, C138S) (Accession)

Molecular Weight

40-52 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1469), CF568 conjugate, 0.1mg/mL
BNC681469-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1469), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10 + C1A/711), CF640R conjugate, 0.1mg/mL
BNC400717-100 1x 100 µL

CD1a (O10 + C1A/711), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), CF488A conjugate, 0.1mg/mL
BNC880828-500 1x 500 µL

CD79a (JCB117 + HM47/A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (HPCA1/1171), CF740 conjugate, 0.1mg/mL
BNC741171-100 1x 100 µL

CD34 (HPCA1/1171), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details