Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-14, Canine

Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF-14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF-14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-14 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf14-protein-canine.html

Purity

98.0

Smiles

KNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQVMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKAGVTPSKSTSASAIMNGGKPVNKSKTT

Molecular Formula

100050897 (Gene_ID) XP_003363267.1 (K64-T252) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WASL Antibody (Biotin)
KB-16592-01 50 μL

WASL Antibody (Biotin)

Sign In for Pricing
View Details
WASL Antibody (Biotin)
KB-16592-02 100 µL

WASL Antibody (Biotin)

Sign In for Pricing
View Details
WASL Antibody (Biotin)
KB-16592-03 1 mL

WASL Antibody (Biotin)

Sign In for Pricing
View Details
Annexin VI (ANXA6) (NM_001155) Human Over-expression Lysate
LC400463 20 µg

Annexin VI (ANXA6) (NM_001155) Human Over-expression Lysate

Sign In for Pricing
View Details
PHKA2 (NM_000292) Human Over-expression Lysate
LY424811 100 µg

PHKA2 (NM_000292) Human Over-expression Lysate

Sign In for Pricing
View Details
TBX20 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D12]
TA809355AM 100 µL

TBX20 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D12]

Sign In for Pricing
View Details