Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-14, Canine

Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF-14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF-14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-14 Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf14-protein-canine.html

Purity

98.0

Smiles

KNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQVMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKAGVTPSKSTSASAIMNGGKPVNKSKTT

Molecular Formula

100050897 (Gene_ID) XP_003363267.1 (K64-T252) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ect2 activation kit by CRISPRa
GA201171 1 Kit

Mouse Ect2 activation kit by CRISPRa

Sign In for Pricing
View Details
Alpha-2-Macroglobulin Antibody
KC-257-01 50 μL

Alpha-2-Macroglobulin Antibody

Sign In for Pricing
View Details
Alpha-2-Macroglobulin Antibody
KC-257-02 100 µL

Alpha-2-Macroglobulin Antibody

Sign In for Pricing
View Details
Alpha-2-Macroglobulin Antibody
KC-257-03 1 mL

Alpha-2-Macroglobulin Antibody

Sign In for Pricing
View Details
NEUROD4 Mouse Monoclonal Antibody [Clone ID: OTI1B7]
CF810658 100 µg

NEUROD4 Mouse Monoclonal Antibody [Clone ID: OTI1B7]

Sign In for Pricing
View Details
XPB (ERCC3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6H8]
TA809371BM 100 µL

XPB (ERCC3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6H8]

Sign In for Pricing
View Details